SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30018.Seq
         (825 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY043293-1|AAK96033.1|  523|Tribolium castaneum homeodomain tran...    22   6.8  
AM292334-1|CAL23146.2|  390|Tribolium castaneum gustatory recept...    22   6.8  
AM292333-1|CAL23145.2|  316|Tribolium castaneum gustatory recept...    22   6.8  
AF187069-1|AAF03889.1|  471|Tribolium castaneum proboscipedia or...    22   6.8  
AF322227-1|AAK01654.1|  782|Tribolium castaneum cell surface pro...    21   9.0  

>AY043293-1|AAK96033.1|  523|Tribolium castaneum homeodomain
           transcription factor Maxillopediaprotein.
          Length = 523

 Score = 21.8 bits (44), Expect = 6.8
 Identities = 12/38 (31%), Positives = 16/38 (42%), Gaps = 1/38 (2%)
 Frame = +3

Query: 414 YFY*K*YEAGEPYKRHKNYXXXXXXXXPG-T*YWHHIS 524
           Y+Y K +   E Y  H+NY        P    Y +H S
Sbjct: 359 YYYNKNHPNSENYINHQNYVQGYQGEHPNYNHYGYHYS 396


>AM292334-1|CAL23146.2|  390|Tribolium castaneum gustatory receptor
           candidate 13 protein.
          Length = 390

 Score = 21.8 bits (44), Expect = 6.8
 Identities = 11/36 (30%), Positives = 19/36 (52%)
 Frame = -2

Query: 437 FVLFSIEIL*VCLTEPSSMFHS*TLLSLVQLYKPYF 330
           F++F    + VC T  +  +    +L ++QLY  YF
Sbjct: 189 FLMFVSYNIYVCQTVSNFEYFQRKILLMIQLYYLYF 224


>AM292333-1|CAL23145.2|  316|Tribolium castaneum gustatory receptor
           candidate 12 protein.
          Length = 316

 Score = 21.8 bits (44), Expect = 6.8
 Identities = 11/36 (30%), Positives = 19/36 (52%)
 Frame = -2

Query: 437 FVLFSIEIL*VCLTEPSSMFHS*TLLSLVQLYKPYF 330
           F++F    + VC T  +  +    +L ++QLY  YF
Sbjct: 115 FLMFVSYNIYVCQTVSNFEYFQRKILLMIQLYYLYF 150


>AF187069-1|AAF03889.1|  471|Tribolium castaneum proboscipedia
           ortholog protein.
          Length = 471

 Score = 21.8 bits (44), Expect = 6.8
 Identities = 12/38 (31%), Positives = 16/38 (42%), Gaps = 1/38 (2%)
 Frame = +3

Query: 414 YFY*K*YEAGEPYKRHKNYXXXXXXXXPG-T*YWHHIS 524
           Y+Y K +   E Y  H+NY        P    Y +H S
Sbjct: 307 YYYNKNHPNSENYINHQNYVQGYQGEHPNYNHYGYHYS 344


>AF322227-1|AAK01654.1|  782|Tribolium castaneum cell surface
           protein chaoptin protein.
          Length = 782

 Score = 21.4 bits (43), Expect = 9.0
 Identities = 11/38 (28%), Positives = 19/38 (50%)
 Frame = +1

Query: 469 IPHNPAPAIPVLSTGIISAQSLEGFTIKAVTIDSRA*G 582
           + HN    +P+ S  + SAQ+L    +   +I S + G
Sbjct: 350 VSHNLLGKLPLTSLSLASAQTLSELDLSWNSISSLSHG 387


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 177,731
Number of Sequences: 336
Number of extensions: 3765
Number of successful extensions: 6
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 122,585
effective HSP length: 56
effective length of database: 103,769
effective search space used: 22621642
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -