SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30011.Seq
         (628 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr...    24   1.2  
U09586-3|AAC47272.1|  470|Tribolium castaneum integrase protein.       23   1.6  
AF227923-1|AAF36721.1|  351|Tribolium castaneum abdominal-B prot...    22   3.7  
AY337337-2|AAP94193.1|  491|Tribolium castaneum cytochrome P450 ...    22   4.8  
AF322227-1|AAK01654.1|  782|Tribolium castaneum cell surface pro...    22   4.8  
AF251548-1|AAF70178.1|  491|Tribolium castaneum cytochrome P450 ...    22   4.8  

>AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like
           protein protein.
          Length = 1156

 Score = 23.8 bits (49), Expect = 1.2
 Identities = 9/22 (40%), Positives = 14/22 (63%)
 Frame = +2

Query: 377 SHWTXHHVRAALVTGGRHRSSR 442
           SH+  H +R+   +GGR R +R
Sbjct: 571 SHYKEHIMRSITESGGRRRQTR 592


>U09586-3|AAC47272.1|  470|Tribolium castaneum integrase protein.
          Length = 470

 Score = 23.4 bits (48), Expect = 1.6
 Identities = 11/34 (32%), Positives = 14/34 (41%)
 Frame = -1

Query: 178 LSSAVHIRRTPSARTVESRQRSLXSYPNRRYGSW 77
           LSS  H    PS R +    R   +Y    + SW
Sbjct: 286 LSSIRHPESNPSERVMRELGRIFRAYCRENHASW 319


>AF227923-1|AAF36721.1|  351|Tribolium castaneum abdominal-B
           protein.
          Length = 351

 Score = 22.2 bits (45), Expect = 3.7
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = -2

Query: 153 GHQVHAQWKVVN 118
           GH +HAQ  VVN
Sbjct: 327 GHHIHAQHHVVN 338


>AY337337-2|AAP94193.1|  491|Tribolium castaneum cytochrome P450
           monooxygenase protein.
          Length = 491

 Score = 21.8 bits (44), Expect = 4.8
 Identities = 7/16 (43%), Positives = 11/16 (68%)
 Frame = -3

Query: 458 WRRRRXSMTCAFHLSL 411
           W+ RR  +T AFH ++
Sbjct: 123 WQNRRKILTPAFHFNI 138



 Score = 21.4 bits (43), Expect = 6.4
 Identities = 9/21 (42%), Positives = 11/21 (52%)
 Frame = -1

Query: 160 IRRTPSARTVESRQRSLXSYP 98
           I RTP    +  R+R L  YP
Sbjct: 48  IMRTPEQMFLADRERGLKYYP 68


>AF322227-1|AAK01654.1|  782|Tribolium castaneum cell surface
           protein chaoptin protein.
          Length = 782

 Score = 21.8 bits (44), Expect = 4.8
 Identities = 7/18 (38%), Positives = 9/18 (50%)
 Frame = -3

Query: 482 CTSGELETWRRRRXSMTC 429
           C  G +E W R+R    C
Sbjct: 712 CDLGWVEVWERKRRQYLC 729


>AF251548-1|AAF70178.1|  491|Tribolium castaneum cytochrome P450
           monooxigenase CYP4Q4 protein.
          Length = 491

 Score = 21.8 bits (44), Expect = 4.8
 Identities = 7/16 (43%), Positives = 11/16 (68%)
 Frame = -3

Query: 458 WRRRRXSMTCAFHLSL 411
           W+ RR  +T AFH ++
Sbjct: 123 WQNRRKILTPAFHFNI 138



 Score = 21.0 bits (42), Expect = 8.4
 Identities = 9/21 (42%), Positives = 11/21 (52%)
 Frame = -1

Query: 160 IRRTPSARTVESRQRSLXSYP 98
           I RTP    +  R+R L  YP
Sbjct: 48  IMRTPEQLFLAERERGLKYYP 68


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 130,993
Number of Sequences: 336
Number of extensions: 2533
Number of successful extensions: 9
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 122,585
effective HSP length: 54
effective length of database: 104,441
effective search space used: 16083914
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -