Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= heS30116
         (469 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF442747-1|AAL40947.1|  669|Tribolium castaneum ABC transmembran...    22   3.3  
AF422804-1|AAL56571.1|  669|Tribolium castaneum ABC transmembran...    22   3.3  
AY337337-1|AAP94192.1|  505|Tribolium castaneum cytochrome P450 ...    21   7.5  
AF254755-1|AAF70496.1|  505|Tribolium castaneum cytochrome P450 ...    21   7.5  

>AF442747-1|AAL40947.1|  669|Tribolium castaneum ABC transmembrane
           transporter protein.
          Length = 669

 Score = 21.8 bits (44), Expect = 3.3
 Identities = 19/51 (37%), Positives = 23/51 (45%), Gaps = 1/51 (1%)
 Frame = -2

Query: 255 RFPITAQERIMRHNAQLSFSIIWHCVSLSRIM-LCN*PLLNGSFLITDQFF 106
           RF I     I+  N  +SF  +  CVS S  M L   P L   FL+   FF
Sbjct: 525 RFYIACGIMILVANVAISFGYLISCVSRSVSMALSIGPPLVIPFLLFGGFF 575


>AF422804-1|AAL56571.1|  669|Tribolium castaneum ABC transmembrane
           transporter white protein.
          Length = 669

 Score = 21.8 bits (44), Expect = 3.3
 Identities = 19/51 (37%), Positives = 23/51 (45%), Gaps = 1/51 (1%)
 Frame = -2

Query: 255 RFPITAQERIMRHNAQLSFSIIWHCVSLSRIM-LCN*PLLNGSFLITDQFF 106
           RF I     I+  N  +SF  +  CVS S  M L   P L   FL+   FF
Sbjct: 525 RFYIACGIMILVANVAISFGYLISCVSRSVSMALSIGPPLVIPFLLFGGFF 575


>AY337337-1|AAP94192.1|  505|Tribolium castaneum cytochrome P450
           monooxygenase protein.
          Length = 505

 Score = 20.6 bits (41), Expect = 7.5
 Identities = 7/13 (53%), Positives = 11/13 (84%)
 Frame = -3

Query: 245 LQHKSALCGIMLN 207
           L+ K+A+CGI+ N
Sbjct: 459 LELKAAICGILAN 471


>AF254755-1|AAF70496.1|  505|Tribolium castaneum cytochrome P450
           monooxigenase CYP4Q7 protein.
          Length = 505

 Score = 20.6 bits (41), Expect = 7.5
 Identities = 7/13 (53%), Positives = 11/13 (84%)
 Frame = -3

Query: 245 LQHKSALCGIMLN 207
           L+ K+A+CGI+ N
Sbjct: 459 LELKAAICGILAN 471


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 80,183
Number of Sequences: 336
Number of extensions: 1399
Number of successful extensions: 4
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 122,585
effective HSP length: 52
effective length of database: 105,113
effective search space used: 10826639
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)