SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B18
         (656 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292378-1|CAL23190.2|  387|Tribolium castaneum gustatory recept...    25   0.72 
AM292369-1|CAL23181.1|  408|Tribolium castaneum gustatory recept...    24   1.3  
AM292340-1|CAL23152.1|  355|Tribolium castaneum gustatory recept...    23   1.7  
AY362543-1|AAQ63455.1|  677|Tribolium castaneum chitin synthase ...    22   3.9  
AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ...    22   3.9  
AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ...    22   3.9  
EU019711-1|ABU25223.1|  534|Tribolium castaneum chitin deacetyla...    21   6.7  
AM292368-1|CAL23180.2|  387|Tribolium castaneum gustatory recept...    21   8.9  
AM292347-1|CAL23159.2|  387|Tribolium castaneum gustatory recept...    21   8.9  
AM292344-1|CAL23156.1|  291|Tribolium castaneum gustatory recept...    21   8.9  
AM292327-1|CAL23139.2|  387|Tribolium castaneum gustatory recept...    21   8.9  
AF452568-1|AAL57830.1|  243|Tribolium castaneum homeodomain tran...    21   8.9  
AF321227-5|AAK16425.1|  292|Tribolium castaneum Zen2 protein.          21   8.9  

>AM292378-1|CAL23190.2|  387|Tribolium castaneum gustatory receptor
           candidate 57 protein.
          Length = 387

 Score = 24.6 bits (51), Expect = 0.72
 Identities = 11/25 (44%), Positives = 14/25 (56%)
 Frame = +2

Query: 20  LRQNEYYFGYVPTYYIPNPNTQLIF 94
           +R  +YY G   TYY+ N    LIF
Sbjct: 141 VRMFQYYIGRSFTYYVCNTTIFLIF 165



 Score = 21.4 bits (43), Expect = 6.7
 Identities = 9/21 (42%), Positives = 10/21 (47%)
 Frame = -1

Query: 284 FRHCYNLNMSRIFVCCIKFLF 222
           F   Y L+   IF CC K  F
Sbjct: 93  FNQGYELSKQEIFNCCSKKSF 113


>AM292369-1|CAL23181.1|  408|Tribolium castaneum gustatory receptor
           candidate 48 protein.
          Length = 408

 Score = 23.8 bits (49), Expect = 1.3
 Identities = 9/32 (28%), Positives = 18/32 (56%)
 Frame = -3

Query: 264 EYESYLRLLY*IFIFTYYRAKVYFLMIYHLTF 169
           E   Y+ LL  +F+F Y+   +Y   +Y++ +
Sbjct: 133 ERNDYVSLLQLVFVFCYF---IYLFTVYYIYY 161


>AM292340-1|CAL23152.1|  355|Tribolium castaneum gustatory receptor
           candidate 19 protein.
          Length = 355

 Score = 23.4 bits (48), Expect = 1.7
 Identities = 10/31 (32%), Positives = 18/31 (58%)
 Frame = -3

Query: 249 LRLLY*IFIFTYYRAKVYFLMIYHLTFIFIL 157
           + LL+ + I+ +Y A +  L IY+    FI+
Sbjct: 277 MHLLFLLCIYYFYCALIILLCIYYFCRAFII 307


>AY362543-1|AAQ63455.1|  677|Tribolium castaneum chitin synthase
           protein.
          Length = 677

 Score = 22.2 bits (45), Expect = 3.9
 Identities = 13/43 (30%), Positives = 21/43 (48%), Gaps = 4/43 (9%)
 Frame = +1

Query: 34  ILLWL----CTYILHTKSKYSINISLEVIVFCD*YNLYLSTLL 150
           I +WL     TYI +   K+S  + ++ + F    NL +  LL
Sbjct: 132 IWVWLINISATYICYAFGKFSCKVMIQSVSFAFPINLSVPVLL 174


>AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase
           protein.
          Length = 1464

 Score = 22.2 bits (45), Expect = 3.9
 Identities = 13/43 (30%), Positives = 21/43 (48%), Gaps = 4/43 (9%)
 Frame = +1

Query: 34  ILLWL----CTYILHTKSKYSINISLEVIVFCD*YNLYLSTLL 150
           I +WL     TYI +   K+S  + ++ + F    NL +  LL
Sbjct: 365 IWVWLINISATYICYAFGKFSCKVMIQSVSFAFPINLSVPVLL 407


>AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase
           CHS2 protein.
          Length = 1464

 Score = 22.2 bits (45), Expect = 3.9
 Identities = 13/43 (30%), Positives = 21/43 (48%), Gaps = 4/43 (9%)
 Frame = +1

Query: 34  ILLWL----CTYILHTKSKYSINISLEVIVFCD*YNLYLSTLL 150
           I +WL     TYI +   K+S  + ++ + F    NL +  LL
Sbjct: 365 IWVWLINISATYICYAFGKFSCKVMIQSVSFAFPINLSVPVLL 407


>EU019711-1|ABU25223.1|  534|Tribolium castaneum chitin deacetylase
           1 protein.
          Length = 534

 Score = 21.4 bits (43), Expect = 6.7
 Identities = 8/24 (33%), Positives = 13/24 (54%)
 Frame = -3

Query: 459 GCNLPFAFFVFKMYSFFTAFSGNH 388
           GC++   FFV   Y+ ++A    H
Sbjct: 224 GCDIKATFFVSHKYTNYSAVQEMH 247


>AM292368-1|CAL23180.2|  387|Tribolium castaneum gustatory receptor
           candidate 47 protein.
          Length = 387

 Score = 21.0 bits (42), Expect = 8.9
 Identities = 7/22 (31%), Positives = 12/22 (54%)
 Frame = -2

Query: 73  IWYVICRYITKVIFVLAQTSLN 8
           +WY+ CR +      LA++  N
Sbjct: 175 LWYINCRAVGNASTALAESFQN 196


>AM292347-1|CAL23159.2|  387|Tribolium castaneum gustatory receptor
           candidate 26 protein.
          Length = 387

 Score = 21.0 bits (42), Expect = 8.9
 Identities = 7/22 (31%), Positives = 12/22 (54%)
 Frame = -2

Query: 73  IWYVICRYITKVIFVLAQTSLN 8
           +WY+ CR +      LA++  N
Sbjct: 175 LWYINCRAVGNASTALAESFQN 196


>AM292344-1|CAL23156.1|  291|Tribolium castaneum gustatory receptor
           candidate 23 protein.
          Length = 291

 Score = 21.0 bits (42), Expect = 8.9
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = -3

Query: 315 KEYWLPLCC 289
           K YWL +CC
Sbjct: 54  KYYWLNVCC 62


>AM292327-1|CAL23139.2|  387|Tribolium castaneum gustatory receptor
           candidate 6 protein.
          Length = 387

 Score = 21.0 bits (42), Expect = 8.9
 Identities = 7/22 (31%), Positives = 12/22 (54%)
 Frame = -2

Query: 73  IWYVICRYITKVIFVLAQTSLN 8
           +WY+ CR +      LA++  N
Sbjct: 175 LWYINCRAVGNASTALAESFQN 196


>AF452568-1|AAL57830.1|  243|Tribolium castaneum homeodomain
           transcription factor Zen2 protein.
          Length = 243

 Score = 21.0 bits (42), Expect = 8.9
 Identities = 7/16 (43%), Positives = 11/16 (68%)
 Frame = +2

Query: 236 YNKRRYDSYSNYNNVE 283
           +N +   +YSNYNN +
Sbjct: 213 FNYQYNQAYSNYNNYQ 228


>AF321227-5|AAK16425.1|  292|Tribolium castaneum Zen2 protein.
          Length = 292

 Score = 21.0 bits (42), Expect = 8.9
 Identities = 7/16 (43%), Positives = 11/16 (68%)
 Frame = +2

Query: 236 YNKRRYDSYSNYNNVE 283
           +N +   +YSNYNN +
Sbjct: 233 FNYQYNQAYSNYNNYQ 248


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 132,827
Number of Sequences: 336
Number of extensions: 2796
Number of successful extensions: 21
Number of sequences better than 10.0: 13
Number of HSP's better than 10.0 without gapping: 18
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 21
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 16969115
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -