SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B16
         (656 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292354-1|CAL23166.1|  321|Tribolium castaneum gustatory recept...    23   1.7  
AJ621748-1|CAF21851.1|  228|Tribolium castaneum zinc finger tran...    21   6.7  
AM292334-1|CAL23146.2|  390|Tribolium castaneum gustatory recept...    21   8.9  
AM292333-1|CAL23145.2|  316|Tribolium castaneum gustatory recept...    21   8.9  

>AM292354-1|CAL23166.1|  321|Tribolium castaneum gustatory receptor
           candidate 33 protein.
          Length = 321

 Score = 23.4 bits (48), Expect = 1.7
 Identities = 14/43 (32%), Positives = 21/43 (48%)
 Frame = +1

Query: 280 KGYWSNVPLLLKLFED*KKRNNRVMKYL*ILNL*TKHSICESV 408
           K YWS     LKL +  K R N     L ++N+    ++C +V
Sbjct: 77  KKYWSEFLANLKLLKGRKIRKNLYYLLLFVINVLYVLTLCYAV 119



 Score = 21.4 bits (43), Expect = 6.7
 Identities = 8/14 (57%), Positives = 11/14 (78%)
 Frame = -3

Query: 351 DTVVSFLLIFEQLQ 310
           DTVV+FL++  Q Q
Sbjct: 307 DTVVAFLMVVAQFQ 320


>AJ621748-1|CAF21851.1|  228|Tribolium castaneum zinc finger
           transcription factor protein.
          Length = 228

 Score = 21.4 bits (43), Expect = 6.7
 Identities = 7/23 (30%), Positives = 11/23 (47%)
 Frame = +2

Query: 482 RKGWLSVTCLARHESRERTKMAA 550
           R  W  + CL + + +    MAA
Sbjct: 81  RSNWFKIHCLLQEQQQAGANMAA 103


>AM292334-1|CAL23146.2|  390|Tribolium castaneum gustatory receptor
           candidate 13 protein.
          Length = 390

 Score = 21.0 bits (42), Expect = 8.9
 Identities = 8/24 (33%), Positives = 15/24 (62%)
 Frame = -1

Query: 437 IHTSDFTTCSTLSQIECFVYKLRI 366
           + T+D  T +T+ + EC+  K+ I
Sbjct: 248 LDTADVKTLTTVVEKECYKMKVTI 271


>AM292333-1|CAL23145.2|  316|Tribolium castaneum gustatory receptor
           candidate 12 protein.
          Length = 316

 Score = 21.0 bits (42), Expect = 8.9
 Identities = 8/24 (33%), Positives = 15/24 (62%)
 Frame = -1

Query: 437 IHTSDFTTCSTLSQIECFVYKLRI 366
           + T+D  T +T+ + EC+  K+ I
Sbjct: 174 LDTADVKTLTTVVEKECYKMKVTI 197


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 148,174
Number of Sequences: 336
Number of extensions: 3030
Number of successful extensions: 7
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 16969115
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -