SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B14
         (558 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ138189-1|ABA03053.1|  162|Tribolium castaneum bursicon protein.      22   3.1  
AM292374-1|CAL23186.2|  659|Tribolium castaneum gustatory recept...    22   3.1  
AM292345-1|CAL23157.2|  384|Tribolium castaneum gustatory recept...    22   3.1  
AY052622-1|AAL15470.1|  290|Tribolium castaneum kynurenine 3-mon...    21   7.2  
AY052393-1|AAL15467.1|  445|Tribolium castaneum kynurenine 3-mon...    21   7.2  
AY052391-1|AAL15465.1|  445|Tribolium castaneum kynurenine 3-mon...    21   7.2  
AY873913-1|AAW67569.2|  377|Tribolium castaneum chitinase 2 prot...    21   9.5  
AM292330-1|CAL23142.2|  408|Tribolium castaneum gustatory recept...    21   9.5  
AM292323-1|CAL23135.2|  587|Tribolium castaneum gustatory recept...    21   9.5  

>DQ138189-1|ABA03053.1|  162|Tribolium castaneum bursicon protein.
          Length = 162

 Score = 22.2 bits (45), Expect = 3.1
 Identities = 9/17 (52%), Positives = 14/17 (82%), Gaps = 1/17 (5%)
 Frame = -1

Query: 195 IALIT-WRLGIFSSSVC 148
           ++L+T W+L IF SS+C
Sbjct: 5   LSLVTLWKLTIFLSSMC 21


>AM292374-1|CAL23186.2|  659|Tribolium castaneum gustatory receptor
           candidate 53 protein.
          Length = 659

 Score = 22.2 bits (45), Expect = 3.1
 Identities = 9/22 (40%), Positives = 12/22 (54%)
 Frame = -1

Query: 126 LATMTPSLKRYS*IATRFCLGI 61
           L T TP   ++   + RFCL I
Sbjct: 302 LVTFTPDRSKFRPSSLRFCLNI 323


>AM292345-1|CAL23157.2|  384|Tribolium castaneum gustatory receptor
           candidate 24 protein.
          Length = 384

 Score = 22.2 bits (45), Expect = 3.1
 Identities = 9/22 (40%), Positives = 12/22 (54%)
 Frame = -1

Query: 126 LATMTPSLKRYS*IATRFCLGI 61
           L T TP   ++   + RFCL I
Sbjct: 27  LVTFTPDRSKFRPSSLRFCLNI 48


>AY052622-1|AAL15470.1|  290|Tribolium castaneum kynurenine
           3-monooxygenase protein.
          Length = 290

 Score = 21.0 bits (42), Expect = 7.2
 Identities = 11/33 (33%), Positives = 19/33 (57%), Gaps = 1/33 (3%)
 Frame = +2

Query: 89  YEYLFKEGVMVAKKDY-HAPKHTELEKIPNLQV 184
           Y+ L  + +    +DY +    TELEK PN+++
Sbjct: 97  YDALTGQCIYSISRDYLNNVLLTELEKYPNVKI 129


>AY052393-1|AAL15467.1|  445|Tribolium castaneum kynurenine
           3-monooxygenase protein.
          Length = 445

 Score = 21.0 bits (42), Expect = 7.2
 Identities = 11/33 (33%), Positives = 19/33 (57%), Gaps = 1/33 (3%)
 Frame = +2

Query: 89  YEYLFKEGVMVAKKDY-HAPKHTELEKIPNLQV 184
           Y+ L  + +    +DY +    TELEK PN+++
Sbjct: 97  YDALTGQCIYSISRDYLNNVLLTELEKYPNVKI 129


>AY052391-1|AAL15465.1|  445|Tribolium castaneum kynurenine
           3-monooxygenase protein.
          Length = 445

 Score = 21.0 bits (42), Expect = 7.2
 Identities = 11/33 (33%), Positives = 19/33 (57%), Gaps = 1/33 (3%)
 Frame = +2

Query: 89  YEYLFKEGVMVAKKDY-HAPKHTELEKIPNLQV 184
           Y+ L  + +    +DY +    TELEK PN+++
Sbjct: 97  YDALTGQCIYSISRDYLNNVLLTELEKYPNVKI 129


>AY873913-1|AAW67569.2|  377|Tribolium castaneum chitinase 2
           protein.
          Length = 377

 Score = 20.6 bits (41), Expect = 9.5
 Identities = 9/23 (39%), Positives = 13/23 (56%)
 Frame = -3

Query: 298 QEYSQVFNTLIG*VPVKVPPGKL 230
           +EY  V +T++  V     PGKL
Sbjct: 231 REYENVNSTVVNWVNAGADPGKL 253


>AM292330-1|CAL23142.2|  408|Tribolium castaneum gustatory receptor
           candidate 9 protein.
          Length = 408

 Score = 20.6 bits (41), Expect = 9.5
 Identities = 10/38 (26%), Positives = 20/38 (52%)
 Frame = -3

Query: 556 VFXLLKL*SRPATSIASLKFKIS*AWTNISLFIMRCNT 443
           +F L++     A  + ++  +I+  WT   LF+M  +T
Sbjct: 200 IFALVEYDIFKALVLQTINLQITFIWTYNDLFVMLIST 237


>AM292323-1|CAL23135.2|  587|Tribolium castaneum gustatory receptor
           candidate 2 protein.
          Length = 587

 Score = 20.6 bits (41), Expect = 9.5
 Identities = 10/38 (26%), Positives = 20/38 (52%)
 Frame = -3

Query: 556 VFXLLKL*SRPATSIASLKFKIS*AWTNISLFIMRCNT 443
           +F L++     A  + ++  +I+  WT   LF+M  +T
Sbjct: 200 IFALVEYDIFKALVLQTINLQITFIWTYNDLFVMLIST 237


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 125,830
Number of Sequences: 336
Number of extensions: 2503
Number of successful extensions: 9
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 122,585
effective HSP length: 54
effective length of database: 104,441
effective search space used: 13681771
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -