SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B12
         (402 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF592536-1|ABQ95982.1|  598|Tribolium castaneum beta-N-acetylglu...    23   1.5  
DQ855503-1|ABH88190.1|  124|Tribolium castaneum chemosensory pro...    21   4.5  
DQ855501-1|ABH88188.1|  146|Tribolium castaneum chemosensory pro...    21   6.0  
AM292343-1|CAL23155.2|  301|Tribolium castaneum gustatory recept...    21   6.0  
EF222290-1|ABN79650.1|  378|Tribolium castaneum adipokinetic hor...    20   7.9  
DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro...    20   7.9  
DQ422965-1|ABE02225.1|  378|Tribolium castaneum adipokinetic hor...    20   7.9  

>EF592536-1|ABQ95982.1|  598|Tribolium castaneum
           beta-N-acetylglucosaminidase NAG1 protein.
          Length = 598

 Score = 22.6 bits (46), Expect = 1.5
 Identities = 7/14 (50%), Positives = 10/14 (71%)
 Frame = +2

Query: 143 GYPAAKLRSYHWSV 184
           G  A+KL S+HW +
Sbjct: 233 GMAASKLNSFHWHI 246


>DQ855503-1|ABH88190.1|  124|Tribolium castaneum chemosensory
          protein 17 protein.
          Length = 124

 Score = 21.0 bits (42), Expect = 4.5
 Identities = 7/12 (58%), Positives = 11/12 (91%)
 Frame = +1

Query: 13 IVKSDKMTKRYL 48
          I+K+D++TK YL
Sbjct: 32 ILKNDRLTKNYL 43


>DQ855501-1|ABH88188.1|  146|Tribolium castaneum chemosensory
          protein 15 protein.
          Length = 146

 Score = 20.6 bits (41), Expect = 6.0
 Identities = 7/12 (58%), Positives = 11/12 (91%)
 Frame = +1

Query: 13 IVKSDKMTKRYL 48
          I+K+D+MT+ YL
Sbjct: 31 ILKNDQMTRNYL 42


>AM292343-1|CAL23155.2|  301|Tribolium castaneum gustatory receptor
           candidate 22 protein.
          Length = 301

 Score = 20.6 bits (41), Expect = 6.0
 Identities = 11/28 (39%), Positives = 15/28 (53%)
 Frame = -2

Query: 179 TSGRIVILLQDIHIGRILIFECDMTIYH 96
           TS   V+L+ D+H    +IF  DM   H
Sbjct: 162 TSMNFVLLIGDLHTSIYIIF-FDMFYQH 188


>EF222290-1|ABN79650.1|  378|Tribolium castaneum adipokinetic
           hormone receptor protein.
          Length = 378

 Score = 20.2 bits (40), Expect = 7.9
 Identities = 7/18 (38%), Positives = 11/18 (61%)
 Frame = -2

Query: 131 ILIFECDMTIYHIFCITY 78
           +L+F    T Y++ CI Y
Sbjct: 281 VLVFFVCWTPYYVMCIWY 298


>DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10
           protein.
          Length = 2700

 Score = 20.2 bits (40), Expect = 7.9
 Identities = 12/37 (32%), Positives = 16/37 (43%)
 Frame = +3

Query: 84  YAEDVVDRHITFKNQNAPNVDILQQNYDPTTGQ*RLS 194
           YA   +D H      N    DI+Q  Y   TG  R++
Sbjct: 209 YAFATIDPHNFNMISNDDESDIIQGGYISVTGLKRVN 245


>DQ422965-1|ABE02225.1|  378|Tribolium castaneum adipokinetic
           hormone receptor protein.
          Length = 378

 Score = 20.2 bits (40), Expect = 7.9
 Identities = 7/18 (38%), Positives = 11/18 (61%)
 Frame = -2

Query: 131 ILIFECDMTIYHIFCITY 78
           +L+F    T Y++ CI Y
Sbjct: 281 VLVFFVCWTPYYVMCIWY 298


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 78,726
Number of Sequences: 336
Number of extensions: 1509
Number of successful extensions: 12
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 12
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12
length of database: 122,585
effective HSP length: 51
effective length of database: 105,449
effective search space used:  8646818
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 39 (20.8 bits)

- SilkBase 1999-2022 -