SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B11
         (654 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF506023-1|AAM46899.1|   76|Tribolium castaneum polyubiquitin pr...   141   5e-36
AF506022-1|AAM46898.1|  685|Tribolium castaneum polyubiquitin pr...   141   5e-36
AF506021-1|AAM46897.1|   64|Tribolium castaneum polyubiquitin pr...   129   2e-32
AF506020-1|AAM46896.1|  112|Tribolium castaneum polyubiquitin pr...   127   9e-32
EF127810-1|ABL67947.1|  311|Tribolium castaneum nicotinic acetyl...    25   0.41 
EF127809-1|ABL67946.1|  311|Tribolium castaneum nicotinic acetyl...    25   0.41 
EF127808-1|ABL67945.1|  311|Tribolium castaneum nicotinic acetyl...    25   0.41 
EF127807-1|ABL67944.1|  311|Tribolium castaneum nicotinic acetyl...    25   0.41 
EF127806-1|ABL67943.1|  311|Tribolium castaneum nicotinic acetyl...    25   0.41 
AM292344-1|CAL23156.1|  291|Tribolium castaneum gustatory recept...    23   2.9  
EF222296-1|ABN79656.2|  403|Tribolium castaneum arginine vasopre...    22   5.1  

>AF506023-1|AAM46899.1|   76|Tribolium castaneum polyubiquitin
           protein.
          Length = 76

 Score =  141 bits (341), Expect = 5e-36
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70


>AF506022-1|AAM46898.1|  685|Tribolium castaneum polyubiquitin
           protein.
          Length = 685

 Score =  141 bits (341), Expect = 5e-36
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70



 Score =  141 bits (341), Expect = 5e-36
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 137 IQKESTLHLV 146



 Score =  141 bits (341), Expect = 5e-36
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 153 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 213 IQKESTLHLV 222



 Score =  141 bits (341), Expect = 5e-36
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 229 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 288

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 289 IQKESTLHLV 298



 Score =  141 bits (341), Expect = 5e-36
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 305 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 364

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 365 IQKESTLHLV 374



 Score =  141 bits (341), Expect = 5e-36
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 457 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 516

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 517 IQKESTLHLV 526



 Score =  141 bits (341), Expect = 5e-36
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 533 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 592

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 593 IQKESTLHLV 602



 Score =  141 bits (341), Expect = 5e-36
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 609 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 668

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 669 IQKESTLHLV 678



 Score =  138 bits (335), Expect = 3e-35
 Identities = 67/70 (95%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQR  FAGKQLEDGRTLSDYN
Sbjct: 381 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRSIFAGKQLEDGRTLSDYN 440

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 441 IQKESTLHLV 450


>AF506021-1|AAM46897.1|   64|Tribolium castaneum polyubiquitin
           protein.
          Length = 64

 Score =  129 bits (312), Expect = 2e-32
 Identities = 62/64 (96%), Positives = 63/64 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQKE 436
           IQKE
Sbjct: 61  IQKE 64


>AF506020-1|AAM46896.1|  112|Tribolium castaneum polyubiquitin
           protein.
          Length = 112

 Score =  127 bits (306), Expect = 9e-32
 Identities = 61/64 (95%), Positives = 62/64 (96%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQR  FAGKQLEDGRTLSDYN
Sbjct: 49  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRSIFAGKQLEDGRTLSDYN 108

Query: 447 IQKE 436
           IQKE
Sbjct: 109 IQKE 112



 Score = 86.6 bits (205), Expect = 2e-19
 Identities = 40/42 (95%), Positives = 41/42 (97%)
 Frame = -1

Query: 543 KIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQKESTLHLV 418
           KIQDKEGIPP+QQRL FAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 1   KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 42


>EF127810-1|ABL67947.1|  311|Tribolium castaneum nicotinic
           acetylcholine receptor subunitalpha 6 transcript variant
           5 protein.
          Length = 311

 Score = 25.4 bits (53), Expect = 0.41
 Identities = 12/29 (41%), Positives = 15/29 (51%)
 Frame = +1

Query: 145 LXGTYLFVVVFEXHRAVTLPAVVTVLHHR 231
           L GTY   ++F    +V L  VV   HHR
Sbjct: 273 LLGTYFNCIMFMVASSVVLTVVVLNYHHR 301


>EF127809-1|ABL67946.1|  311|Tribolium castaneum nicotinic
           acetylcholine receptor subunitalpha 6 transcript variant
           4 protein.
          Length = 311

 Score = 25.4 bits (53), Expect = 0.41
 Identities = 12/29 (41%), Positives = 15/29 (51%)
 Frame = +1

Query: 145 LXGTYLFVVVFEXHRAVTLPAVVTVLHHR 231
           L GTY   ++F    +V L  VV   HHR
Sbjct: 273 LIGTYFNCIMFMVASSVVLTVVVLNYHHR 301


>EF127808-1|ABL67945.1|  311|Tribolium castaneum nicotinic
           acetylcholine receptor subunitalpha 6 transcript variant
           3 protein.
          Length = 311

 Score = 25.4 bits (53), Expect = 0.41
 Identities = 12/29 (41%), Positives = 15/29 (51%)
 Frame = +1

Query: 145 LXGTYLFVVVFEXHRAVTLPAVVTVLHHR 231
           L GTY   ++F    +V L  VV   HHR
Sbjct: 273 LLGTYFNCIMFMVASSVVLTVVVLNYHHR 301


>EF127807-1|ABL67944.1|  311|Tribolium castaneum nicotinic
           acetylcholine receptor subunitalpha 6 transcript variant
           2 protein.
          Length = 311

 Score = 25.4 bits (53), Expect = 0.41
 Identities = 12/29 (41%), Positives = 15/29 (51%)
 Frame = +1

Query: 145 LXGTYLFVVVFEXHRAVTLPAVVTVLHHR 231
           L GTY   ++F    +V L  VV   HHR
Sbjct: 273 LLGTYFNCIMFMVASSVVLTVVVLNYHHR 301


>EF127806-1|ABL67943.1|  311|Tribolium castaneum nicotinic
           acetylcholine receptor subunitalpha 6 transcript variant
           1 protein.
          Length = 311

 Score = 25.4 bits (53), Expect = 0.41
 Identities = 12/29 (41%), Positives = 15/29 (51%)
 Frame = +1

Query: 145 LXGTYLFVVVFEXHRAVTLPAVVTVLHHR 231
           L GTY   ++F    +V L  VV   HHR
Sbjct: 273 LIGTYFNCIMFMVASSVVLTVVVLNYHHR 301


>AM292344-1|CAL23156.1|  291|Tribolium castaneum gustatory receptor
           candidate 23 protein.
          Length = 291

 Score = 22.6 bits (46), Expect = 2.9
 Identities = 12/36 (33%), Positives = 18/36 (50%)
 Frame = +2

Query: 254 CSPVHSRRKRWILPFSSTL*NLRTASLTFFFLCLIF 361
           C P  S  + + + FS+T   L  A +TF  + L F
Sbjct: 253 CRPTFSAARFYGIDFSNTFLGLVGAVVTFLIVLLQF 288


>EF222296-1|ABN79656.2|  403|Tribolium castaneum arginine
           vasopressin receptor protein.
          Length = 403

 Score = 21.8 bits (44), Expect = 5.1
 Identities = 11/21 (52%), Positives = 14/21 (66%)
 Frame = +1

Query: 430 GGFLLDIVVRXGTSIFQLLSS 492
           GGFLL  VV+ G ++   LSS
Sbjct: 108 GGFLLCKVVKYGQTLGPYLSS 128


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 120,896
Number of Sequences: 336
Number of extensions: 2231
Number of successful extensions: 21
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 12
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 21
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 16865010
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -