SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B08
         (510 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF127810-1|ABL67947.1|  311|Tribolium castaneum nicotinic acetyl...    22   2.8  
EF127808-1|ABL67945.1|  311|Tribolium castaneum nicotinic acetyl...    22   2.8  
EF127807-1|ABL67944.1|  311|Tribolium castaneum nicotinic acetyl...    22   2.8  
EF127809-1|ABL67946.1|  311|Tribolium castaneum nicotinic acetyl...    21   4.8  
EF127806-1|ABL67943.1|  311|Tribolium castaneum nicotinic acetyl...    21   4.8  
AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept...    21   4.8  
AF236856-1|AAG17563.2|  370|Tribolium castaneum Kruppel protein ...    21   6.4  
AM292340-1|CAL23152.1|  355|Tribolium castaneum gustatory recept...    21   8.4  

>EF127810-1|ABL67947.1|  311|Tribolium castaneum nicotinic
           acetylcholine receptor subunitalpha 6 transcript variant
           5 protein.
          Length = 311

 Score = 22.2 bits (45), Expect = 2.8
 Identities = 9/29 (31%), Positives = 20/29 (68%)
 Frame = -2

Query: 194 SFSLVVLGTFPLIVMFLLAISLAIRILCL 108
           S ++ +LGT+   +MF++A S+ + ++ L
Sbjct: 268 SDAIPLLGTYFNCIMFMVASSVVLTVVVL 296


>EF127808-1|ABL67945.1|  311|Tribolium castaneum nicotinic
           acetylcholine receptor subunitalpha 6 transcript variant
           3 protein.
          Length = 311

 Score = 22.2 bits (45), Expect = 2.8
 Identities = 9/29 (31%), Positives = 20/29 (68%)
 Frame = -2

Query: 194 SFSLVVLGTFPLIVMFLLAISLAIRILCL 108
           S ++ +LGT+   +MF++A S+ + ++ L
Sbjct: 268 SDAIPLLGTYFNCIMFMVASSVVLTVVVL 296


>EF127807-1|ABL67944.1|  311|Tribolium castaneum nicotinic
           acetylcholine receptor subunitalpha 6 transcript variant
           2 protein.
          Length = 311

 Score = 22.2 bits (45), Expect = 2.8
 Identities = 9/29 (31%), Positives = 20/29 (68%)
 Frame = -2

Query: 194 SFSLVVLGTFPLIVMFLLAISLAIRILCL 108
           S ++ +LGT+   +MF++A S+ + ++ L
Sbjct: 268 SDAIPLLGTYFNCIMFMVASSVVLTVVVL 296


>EF127809-1|ABL67946.1|  311|Tribolium castaneum nicotinic
           acetylcholine receptor subunitalpha 6 transcript variant
           4 protein.
          Length = 311

 Score = 21.4 bits (43), Expect = 4.8
 Identities = 8/30 (26%), Positives = 21/30 (70%)
 Frame = -2

Query: 197 SSFSLVVLGTFPLIVMFLLAISLAIRILCL 108
           +S ++ ++GT+   +MF++A S+ + ++ L
Sbjct: 267 TSDAVPLIGTYFNCIMFMVASSVVLTVVVL 296


>EF127806-1|ABL67943.1|  311|Tribolium castaneum nicotinic
           acetylcholine receptor subunitalpha 6 transcript variant
           1 protein.
          Length = 311

 Score = 21.4 bits (43), Expect = 4.8
 Identities = 8/30 (26%), Positives = 21/30 (70%)
 Frame = -2

Query: 197 SSFSLVVLGTFPLIVMFLLAISLAIRILCL 108
           +S ++ ++GT+   +MF++A S+ + ++ L
Sbjct: 267 TSDAVPLIGTYFNCIMFMVASSVVLTVVVL 296


>AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor
           candidate 46 protein.
          Length = 1451

 Score = 21.4 bits (43), Expect = 4.8
 Identities = 12/27 (44%), Positives = 15/27 (55%)
 Frame = -2

Query: 191 FSLVVLGTFPLIVMFLLAISLAIRILC 111
           F L    TF  +V  L+  SLAI +LC
Sbjct: 398 FRLSKTKTFCTLVTALVYCSLAIFVLC 424


>AF236856-1|AAG17563.2|  370|Tribolium castaneum Kruppel protein
           protein.
          Length = 370

 Score = 21.0 bits (42), Expect = 6.4
 Identities = 10/23 (43%), Positives = 14/23 (60%)
 Frame = +1

Query: 130 NEIASKNITMRGNVPKTTKEKED 198
           N ++S N  +RG   KT K +ED
Sbjct: 92  NVVSSTNQEIRGPKRKTWKVEED 114


>AM292340-1|CAL23152.1|  355|Tribolium castaneum gustatory receptor
           candidate 19 protein.
          Length = 355

 Score = 20.6 bits (41), Expect = 8.4
 Identities = 7/14 (50%), Positives = 11/14 (78%)
 Frame = -3

Query: 346 CCYFIVFSIAVLQL 305
           CC FI+F++ +L L
Sbjct: 269 CCAFIIFTMHLLFL 282


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 123,633
Number of Sequences: 336
Number of extensions: 2789
Number of successful extensions: 8
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8
length of database: 122,585
effective HSP length: 53
effective length of database: 104,777
effective search space used: 12154132
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -