SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B07
         (652 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY052394-1|AAL15468.1|  228|Tribolium castaneum tryptophan oxyge...    24   0.94 
AY052392-1|AAL15466.1|  388|Tribolium castaneum tryptophan oxyge...    24   0.94 
AY052390-1|AAL15464.1|  388|Tribolium castaneum tryptophan oxyge...    24   0.94 
AM292380-1|CAL23192.2|  489|Tribolium castaneum gustatory recept...    24   0.94 
AY055847-1|AAL23667.2|  312|Tribolium castaneum cephalothorax pr...    23   2.2  
AY055846-1|AAL26542.2|  312|Tribolium castaneum cephalothorax pr...    23   2.2  
AY055845-1|AAL23670.2|  230|Tribolium castaneum cephalothorax pr...    23   2.2  
AF426396-1|AAL27023.2|  312|Tribolium castaneum cephalothorax pr...    23   2.2  
AF426395-1|AAL27022.2|  297|Tribolium castaneum cephalothorax pr...    23   2.2  
AF261823-1|AAG13010.1|  157|Tribolium castaneum cephalothorax pr...    23   2.2  
AF227628-1|AAF42868.1|  312|Tribolium castaneum sex combs reduce...    23   2.2  
EF592539-1|ABQ95985.1|  630|Tribolium castaneum beta-N-acetylglu...    23   2.9  
DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro...    23   2.9  
AF416773-1|AAL09697.1|  268|Tribolium castaneum cephalothorax pr...    23   2.9  
AF321227-2|AAK16422.1|  312|Tribolium castaneum Scr protein.           23   2.9  
AF227923-1|AAF36721.1|  351|Tribolium castaneum abdominal-B prot...    23   2.9  
EU019709-1|ABU25221.1|  540|Tribolium castaneum aspartate 1-deca...    22   3.8  
AM292366-1|CAL23178.2|  379|Tribolium castaneum gustatory recept...    22   3.8  
AM292329-1|CAL23141.2|  379|Tribolium castaneum gustatory recept...    22   3.8  
EU008544-1|ABS31131.1|  493|Tribolium castaneum cytochrome P450 ...    21   6.7  
AM292383-1|CAL23195.2|  320|Tribolium castaneum gustatory recept...    21   6.7  
AM292358-1|CAL23170.2|  331|Tribolium castaneum gustatory recept...    21   6.7  
AM292353-1|CAL23165.2|  651|Tribolium castaneum gustatory recept...    21   6.7  

>AY052394-1|AAL15468.1|  228|Tribolium castaneum tryptophan
           oxygenase protein.
          Length = 228

 Score = 24.2 bits (50), Expect = 0.94
 Identities = 11/30 (36%), Positives = 16/30 (53%)
 Frame = +1

Query: 271 LLVEPFVASEGLAEGGDRCLWYLKAPLRDR 360
           L+V+  + S  L  GG     YL++ L DR
Sbjct: 151 LMVQRMIGSSQLGTGGSSGYQYLRSTLSDR 180


>AY052392-1|AAL15466.1|  388|Tribolium castaneum tryptophan
           oxygenase protein.
          Length = 388

 Score = 24.2 bits (50), Expect = 0.94
 Identities = 11/30 (36%), Positives = 16/30 (53%)
 Frame = +1

Query: 271 LLVEPFVASEGLAEGGDRCLWYLKAPLRDR 360
           L+V+  + S  L  GG     YL++ L DR
Sbjct: 311 LMVQRMIGSSQLGTGGSSGYQYLRSTLSDR 340


>AY052390-1|AAL15464.1|  388|Tribolium castaneum tryptophan
           oxygenase protein.
          Length = 388

 Score = 24.2 bits (50), Expect = 0.94
 Identities = 11/30 (36%), Positives = 16/30 (53%)
 Frame = +1

Query: 271 LLVEPFVASEGLAEGGDRCLWYLKAPLRDR 360
           L+V+  + S  L  GG     YL++ L DR
Sbjct: 311 LMVQRMIGSSQLGTGGSSGYQYLRSTLSDR 340


>AM292380-1|CAL23192.2|  489|Tribolium castaneum gustatory receptor
           candidate 59 protein.
          Length = 489

 Score = 24.2 bits (50), Expect = 0.94
 Identities = 12/35 (34%), Positives = 21/35 (60%)
 Frame = +2

Query: 188 LVDVLIYGAQTRRLTEKVRRETQWAVLIYSSSPSS 292
           L   ++Y     R+T+K+   TQ A LI+S+S ++
Sbjct: 54  LTAYMVYITTNLRITQKLSIVTQLADLIFSASANA 88


>AY055847-1|AAL23667.2|  312|Tribolium castaneum cephalothorax
           protein.
          Length = 312

 Score = 23.0 bits (47), Expect = 2.2
 Identities = 21/66 (31%), Positives = 30/66 (45%), Gaps = 3/66 (4%)
 Frame = -1

Query: 508 EVAHTYRYHCYS*YVPR---L*TIGRYTFLM*SKSIQRQYSYLRAPNVITDPPDPLTVLL 338
           +VA  Y  H Y+   P      T+G YT L   +      ++L++PN  T P        
Sbjct: 47  QVAPQYPQHPYAAPAPGHGLQPTMGDYTQLQPQRLAS---THLQSPNTQTHPSASCKYAD 103

Query: 337 STTSTG 320
           ST+STG
Sbjct: 104 STSSTG 109



 Score = 21.0 bits (42), Expect = 8.8
 Identities = 9/28 (32%), Positives = 13/28 (46%)
 Frame = -3

Query: 320 SPPSANPSLATKGSTSKLTQPTEFLAGP 237
           +PP + PS +    +S LT P      P
Sbjct: 126 TPPLSTPSNSNATKSSGLTSPLSVSTSP 153


>AY055846-1|AAL26542.2|  312|Tribolium castaneum cephalothorax
           protein.
          Length = 312

 Score = 23.0 bits (47), Expect = 2.2
 Identities = 21/66 (31%), Positives = 30/66 (45%), Gaps = 3/66 (4%)
 Frame = -1

Query: 508 EVAHTYRYHCYS*YVPR---L*TIGRYTFLM*SKSIQRQYSYLRAPNVITDPPDPLTVLL 338
           +VA  Y  H Y+   P      T+G YT L   +      ++L++PN  T P        
Sbjct: 47  QVAPQYPQHPYAAPAPGHGLQPTMGDYTQLQPQRLAS---THLQSPNTQTHPSASCKYAD 103

Query: 337 STTSTG 320
           ST+STG
Sbjct: 104 STSSTG 109



 Score = 21.0 bits (42), Expect = 8.8
 Identities = 9/28 (32%), Positives = 13/28 (46%)
 Frame = -3

Query: 320 SPPSANPSLATKGSTSKLTQPTEFLAGP 237
           +PP + PS +    +S LT P      P
Sbjct: 126 TPPLSTPSNSNATKSSGLTSPLSVSTSP 153


>AY055845-1|AAL23670.2|  230|Tribolium castaneum cephalothorax
           protein.
          Length = 230

 Score = 23.0 bits (47), Expect = 2.2
 Identities = 21/66 (31%), Positives = 30/66 (45%), Gaps = 3/66 (4%)
 Frame = -1

Query: 508 EVAHTYRYHCYS*YVPR---L*TIGRYTFLM*SKSIQRQYSYLRAPNVITDPPDPLTVLL 338
           +VA  Y  H Y+   P      T+G YT L   +      ++L++PN  T P        
Sbjct: 47  QVAPQYPQHPYAAPAPGHGLQPTMGDYTQLQPQRLAS---THLQSPNTQTHPSASCKYAD 103

Query: 337 STTSTG 320
           ST+STG
Sbjct: 104 STSSTG 109



 Score = 21.0 bits (42), Expect = 8.8
 Identities = 9/28 (32%), Positives = 13/28 (46%)
 Frame = -3

Query: 320 SPPSANPSLATKGSTSKLTQPTEFLAGP 237
           +PP + PS +    +S LT P      P
Sbjct: 126 TPPLSTPSNSNATKSSGLTSPLSVSTSP 153


>AF426396-1|AAL27023.2|  312|Tribolium castaneum cephalothorax
           protein.
          Length = 312

 Score = 23.0 bits (47), Expect = 2.2
 Identities = 21/66 (31%), Positives = 30/66 (45%), Gaps = 3/66 (4%)
 Frame = -1

Query: 508 EVAHTYRYHCYS*YVPR---L*TIGRYTFLM*SKSIQRQYSYLRAPNVITDPPDPLTVLL 338
           +VA  Y  H Y+   P      T+G YT L   +      ++L++PN  T P        
Sbjct: 47  QVAPQYPQHPYAAPAPGHGLQPTMGDYTQLQPQRLAS---THLQSPNTQTHPSASCKYAD 103

Query: 337 STTSTG 320
           ST+STG
Sbjct: 104 STSSTG 109



 Score = 21.0 bits (42), Expect = 8.8
 Identities = 9/28 (32%), Positives = 13/28 (46%)
 Frame = -3

Query: 320 SPPSANPSLATKGSTSKLTQPTEFLAGP 237
           +PP + PS +    +S LT P      P
Sbjct: 126 TPPLSTPSNSNATKSSGLTSPLSVSTSP 153


>AF426395-1|AAL27022.2|  297|Tribolium castaneum cephalothorax
           protein.
          Length = 297

 Score = 23.0 bits (47), Expect = 2.2
 Identities = 21/66 (31%), Positives = 30/66 (45%), Gaps = 3/66 (4%)
 Frame = -1

Query: 508 EVAHTYRYHCYS*YVPR---L*TIGRYTFLM*SKSIQRQYSYLRAPNVITDPPDPLTVLL 338
           +VA  Y  H Y+   P      T+G YT L   +      ++L++PN  T P        
Sbjct: 47  QVAPQYPQHPYAAPAPGHGLQPTMGDYTQLQPQRLAS---THLQSPNTQTHPSASCKYAD 103

Query: 337 STTSTG 320
           ST+STG
Sbjct: 104 STSSTG 109



 Score = 21.0 bits (42), Expect = 8.8
 Identities = 9/28 (32%), Positives = 13/28 (46%)
 Frame = -3

Query: 320 SPPSANPSLATKGSTSKLTQPTEFLAGP 237
           +PP + PS +    +S LT P      P
Sbjct: 126 TPPLSTPSNSNATKSSGLTSPLSVSTSP 153


>AF261823-1|AAG13010.1|  157|Tribolium castaneum cephalothorax
           protein.
          Length = 157

 Score = 23.0 bits (47), Expect = 2.2
 Identities = 21/66 (31%), Positives = 30/66 (45%), Gaps = 3/66 (4%)
 Frame = -1

Query: 508 EVAHTYRYHCYS*YVPR---L*TIGRYTFLM*SKSIQRQYSYLRAPNVITDPPDPLTVLL 338
           +VA  Y  H Y+   P      T+G YT L   +      ++L++PN  T P        
Sbjct: 47  QVAPQYPQHPYAAPAPGHGLQPTMGDYTQLQPQRLAS---THLQSPNTQTHPSASCKYAD 103

Query: 337 STTSTG 320
           ST+STG
Sbjct: 104 STSSTG 109



 Score = 21.0 bits (42), Expect = 8.8
 Identities = 9/28 (32%), Positives = 13/28 (46%)
 Frame = -3

Query: 320 SPPSANPSLATKGSTSKLTQPTEFLAGP 237
           +PP + PS +    +S LT P      P
Sbjct: 126 TPPLSTPSNSNATKSSGLTSPLSVSTSP 153


>AF227628-1|AAF42868.1|  312|Tribolium castaneum sex combs reduced
           Scr protein.
          Length = 312

 Score = 23.0 bits (47), Expect = 2.2
 Identities = 21/66 (31%), Positives = 30/66 (45%), Gaps = 3/66 (4%)
 Frame = -1

Query: 508 EVAHTYRYHCYS*YVPR---L*TIGRYTFLM*SKSIQRQYSYLRAPNVITDPPDPLTVLL 338
           +VA  Y  H Y+   P      T+G YT L   +      ++L++PN  T P        
Sbjct: 47  QVAPQYPQHPYAAPAPGHGLQPTMGDYTQLQPQRLAS---THLQSPNTQTHPSASCKYAD 103

Query: 337 STTSTG 320
           ST+STG
Sbjct: 104 STSSTG 109



 Score = 21.0 bits (42), Expect = 8.8
 Identities = 9/28 (32%), Positives = 13/28 (46%)
 Frame = -3

Query: 320 SPPSANPSLATKGSTSKLTQPTEFLAGP 237
           +PP + PS +    +S LT P      P
Sbjct: 126 TPPLSTPSNSNATKSSGLTSPLSVSTSP 153


>EF592539-1|ABQ95985.1|  630|Tribolium castaneum
           beta-N-acetylglucosaminidase FDL protein.
          Length = 630

 Score = 22.6 bits (46), Expect = 2.9
 Identities = 6/28 (21%), Positives = 14/28 (50%)
 Frame = +2

Query: 431 KCVPTYCSEPRYVSAVTMIAVSVCHLAC 514
           +C+   C       A+ ++++S C + C
Sbjct: 59  QCINQRCERRHIKGAIPVVSLSTCSMLC 86


>DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein.
          Length = 2700

 Score = 22.6 bits (46), Expect = 2.9
 Identities = 10/21 (47%), Positives = 12/21 (57%)
 Frame = -3

Query: 317  PPSANPSLATKGSTSKLTQPT 255
            PPS      TK +TS  T+PT
Sbjct: 1176 PPSTTNHWQTKTTTSTTTRPT 1196


>AF416773-1|AAL09697.1|  268|Tribolium castaneum cephalothorax
           protein.
          Length = 268

 Score = 22.6 bits (46), Expect = 2.9
 Identities = 15/44 (34%), Positives = 22/44 (50%)
 Frame = -1

Query: 451 TIGRYTFLM*SKSIQRQYSYLRAPNVITDPPDPLTVLLSTTSTG 320
           T+G YT L   +      ++L++PN  T P        ST+STG
Sbjct: 25  TMGDYTQLQPQRLAS---THLQSPNTQTHPSASCKYADSTSSTG 65



 Score = 21.0 bits (42), Expect = 8.8
 Identities = 9/28 (32%), Positives = 13/28 (46%)
 Frame = -3

Query: 320 SPPSANPSLATKGSTSKLTQPTEFLAGP 237
           +PP + PS +    +S LT P      P
Sbjct: 82  TPPLSTPSNSNATKSSGLTSPLSVSTSP 109


>AF321227-2|AAK16422.1|  312|Tribolium castaneum Scr protein.
          Length = 312

 Score = 22.6 bits (46), Expect = 2.9
 Identities = 21/66 (31%), Positives = 30/66 (45%), Gaps = 3/66 (4%)
 Frame = -1

Query: 508 EVAHTYRYHCYS*YVPR---L*TIGRYTFLM*SKSIQRQYSYLRAPNVITDPPDPLTVLL 338
           +VA  Y  H Y+   P      T+G YT L   +      ++L++PN  T P        
Sbjct: 47  QVAPQYPQHPYAAPAPGHGLQPTMGDYTQLQPQRLAP---THLQSPNTQTHPSASCKYAD 103

Query: 337 STTSTG 320
           ST+STG
Sbjct: 104 STSSTG 109



 Score = 21.0 bits (42), Expect = 8.8
 Identities = 9/28 (32%), Positives = 13/28 (46%)
 Frame = -3

Query: 320 SPPSANPSLATKGSTSKLTQPTEFLAGP 237
           +PP + PS +    +S LT P      P
Sbjct: 126 TPPLSTPSNSNATKSSGLTSPLSVSTSP 153


>AF227923-1|AAF36721.1|  351|Tribolium castaneum abdominal-B
           protein.
          Length = 351

 Score = 22.6 bits (46), Expect = 2.9
 Identities = 11/21 (52%), Positives = 13/21 (61%)
 Frame = -3

Query: 320 SPPSANPSLATKGSTSKLTQP 258
           SPP A  S AT  S+S +T P
Sbjct: 10  SPPPAPQSAATPISSSGMTSP 30


>EU019709-1|ABU25221.1|  540|Tribolium castaneum aspartate
           1-decarboxylase protein.
          Length = 540

 Score = 22.2 bits (45), Expect = 3.8
 Identities = 7/14 (50%), Positives = 9/14 (64%)
 Frame = +1

Query: 325 CLWYLKAPLRDRED 366
           C WY+   LR R+D
Sbjct: 460 CFWYVPKSLRGRKD 473


>AM292366-1|CAL23178.2|  379|Tribolium castaneum gustatory receptor
           candidate 45 protein.
          Length = 379

 Score = 22.2 bits (45), Expect = 3.8
 Identities = 9/21 (42%), Positives = 13/21 (61%)
 Frame = +2

Query: 377 VWGSEI*ILPLYRFTLHKKCV 439
           VW  E+ ++ L  +TLH  CV
Sbjct: 156 VWICEMGVVTLQAYTLHLFCV 176


>AM292329-1|CAL23141.2|  379|Tribolium castaneum gustatory receptor
           candidate 8 protein.
          Length = 379

 Score = 22.2 bits (45), Expect = 3.8
 Identities = 9/21 (42%), Positives = 13/21 (61%)
 Frame = +2

Query: 377 VWGSEI*ILPLYRFTLHKKCV 439
           VW  E+ ++ L  +TLH  CV
Sbjct: 156 VWICEMGVVTLQAYTLHLFCV 176


>EU008544-1|ABS31131.1|  493|Tribolium castaneum cytochrome P450
           protein.
          Length = 493

 Score = 21.4 bits (43), Expect = 6.7
 Identities = 8/16 (50%), Positives = 11/16 (68%)
 Frame = -1

Query: 406 RQYSYLRAPNVITDPP 359
           + YSY ++ NV TD P
Sbjct: 19  KHYSYWQSKNVPTDKP 34


>AM292383-1|CAL23195.2|  320|Tribolium castaneum gustatory receptor
           candidate 62 protein.
          Length = 320

 Score = 21.4 bits (43), Expect = 6.7
 Identities = 8/41 (19%), Positives = 18/41 (43%)
 Frame = +2

Query: 149 YADSDSLERLCQFLVDVLIYGAQTRRLTEKVRRETQWAVLI 271
           Y+    +  L Q ++DV++       +   + +  QW  L+
Sbjct: 50  YSTLRPINLLVQIILDVILLILNVHTILTTITKRNQWCKLL 90


>AM292358-1|CAL23170.2|  331|Tribolium castaneum gustatory receptor
           candidate 37 protein.
          Length = 331

 Score = 21.4 bits (43), Expect = 6.7
 Identities = 8/41 (19%), Positives = 18/41 (43%)
 Frame = +2

Query: 149 YADSDSLERLCQFLVDVLIYGAQTRRLTEKVRRETQWAVLI 271
           Y+    +  L Q ++DV++       +   + +  QW  L+
Sbjct: 50  YSTLRPINLLVQIILDVILLILNVHTILTTITKRNQWCKLL 90


>AM292353-1|CAL23165.2|  651|Tribolium castaneum gustatory receptor
           candidate 32 protein.
          Length = 651

 Score = 21.4 bits (43), Expect = 6.7
 Identities = 8/41 (19%), Positives = 18/41 (43%)
 Frame = +2

Query: 149 YADSDSLERLCQFLVDVLIYGAQTRRLTEKVRRETQWAVLI 271
           Y+    +  L Q ++DV++       +   + +  QW  L+
Sbjct: 370 YSTLRPINLLVQIILDVILLILNVHTILTTITKRNQWCKLL 410


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 154,629
Number of Sequences: 336
Number of extensions: 3347
Number of successful extensions: 33
Number of sequences better than 10.0: 23
Number of HSP's better than 10.0 without gapping: 24
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 33
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 16760905
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -