SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B03
         (549 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292339-1|CAL23151.2|  387|Tribolium castaneum gustatory recept...    25   0.44 
AM292338-1|CAL23150.2|  372|Tribolium castaneum gustatory recept...    25   0.44 
AM292382-1|CAL23194.2|  670|Tribolium castaneum gustatory recept...    23   1.8  
AM292354-1|CAL23166.1|  321|Tribolium castaneum gustatory recept...    22   3.1  
S73225-1|AAB30811.1|  327|Tribolium castaneum protein ( Triboliu...    21   5.4  
AY675073-1|AAV74190.1|  533|Tribolium castaneum chitinase 5 prot...    21   7.1  
AY316682-1|AAQ83696.1|  456|Tribolium castaneum Sp-like zinc fin...    21   7.1  
AM292337-1|CAL23149.2|  452|Tribolium castaneum gustatory recept...    21   7.1  
AM292381-1|CAL23193.2|  364|Tribolium castaneum gustatory recept...    21   9.4  
AJ415419-1|CAC94468.1|  441|Tribolium castaneum transcription fa...    21   9.4  
AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr...    21   9.4  

>AM292339-1|CAL23151.2|  387|Tribolium castaneum gustatory receptor
           candidate 18 protein.
          Length = 387

 Score = 25.0 bits (52), Expect = 0.44
 Identities = 14/48 (29%), Positives = 22/48 (45%)
 Frame = -3

Query: 274 TLVDNHTESMSSHVVHATCLSMVYFVWHTLLNCTIASDVYNVSNFVHF 131
           TLV  H+  +++        S+   VW +L+   +  D Y V N V F
Sbjct: 219 TLVQMHSNLVTTSEEVCDSFSIFGLVWISLIFVVLIGDAYAVLNSVLF 266


>AM292338-1|CAL23150.2|  372|Tribolium castaneum gustatory receptor
           candidate 17 protein.
          Length = 372

 Score = 25.0 bits (52), Expect = 0.44
 Identities = 14/48 (29%), Positives = 22/48 (45%)
 Frame = -3

Query: 274 TLVDNHTESMSSHVVHATCLSMVYFVWHTLLNCTIASDVYNVSNFVHF 131
           TLV  H+  +++        S+   VW +L+   +  D Y V N V F
Sbjct: 219 TLVQMHSNLVTTSEEVCDSFSIFGLVWISLIFVVLIGDAYAVLNSVLF 266


>AM292382-1|CAL23194.2|  670|Tribolium castaneum gustatory receptor
           candidate 61 protein.
          Length = 670

 Score = 23.0 bits (47), Expect = 1.8
 Identities = 8/11 (72%), Positives = 8/11 (72%)
 Frame = +2

Query: 194 PHKVYHGKTGR 226
           PH  Y GKTGR
Sbjct: 302 PHPTYFGKTGR 312


>AM292354-1|CAL23166.1|  321|Tribolium castaneum gustatory receptor
           candidate 33 protein.
          Length = 321

 Score = 22.2 bits (45), Expect = 3.1
 Identities = 6/14 (42%), Positives = 9/14 (64%)
 Frame = -3

Query: 532 IFYWTLRYEFVWDR 491
           ++YW  +YE  W R
Sbjct: 119 VYYWRQQYEDFWHR 132


>S73225-1|AAB30811.1|  327|Tribolium castaneum protein ( Tribolium
           castaneum homeodomainprotein mRNA, complete cds. ).
          Length = 327

 Score = 21.4 bits (43), Expect = 5.4
 Identities = 9/22 (40%), Positives = 12/22 (54%)
 Frame = +1

Query: 76  LFARRFRTHGTIPLSTXHESVQ 141
           L A+    H TIPL+   E +Q
Sbjct: 297 LMAQGLYNHSTIPLTKEEEELQ 318


>AY675073-1|AAV74190.1|  533|Tribolium castaneum chitinase 5
           protein.
          Length = 533

 Score = 21.0 bits (42), Expect = 7.1
 Identities = 9/31 (29%), Positives = 13/31 (41%)
 Frame = +1

Query: 364 QRE*EATEGSQGCRQDRQPEETASSP*SCPH 456
           Q E + +   + C+QD  P E       C H
Sbjct: 466 QNEVDGSVAPKECKQDFMPHELCDKYYRCVH 496


>AY316682-1|AAQ83696.1|  456|Tribolium castaneum Sp-like zinc finger
           protein protein.
          Length = 456

 Score = 21.0 bits (42), Expect = 7.1
 Identities = 8/19 (42%), Positives = 9/19 (47%)
 Frame = +3

Query: 429 SQLPLKLPTSSVELRNPSY 485
           S  P  LPT      NP+Y
Sbjct: 78  SSTPSSLPTQRTSTSNPTY 96


>AM292337-1|CAL23149.2|  452|Tribolium castaneum gustatory receptor
           candidate 16 protein.
          Length = 452

 Score = 21.0 bits (42), Expect = 7.1
 Identities = 12/49 (24%), Positives = 20/49 (40%)
 Frame = -3

Query: 271 LVDNHTESMSSHVVHATCLSMVYFVWHTLLNCTIASDVYNVSNFVHFHV 125
           LV+ H   +     H +  S+   +W T+    +  D Y V     FH+
Sbjct: 233 LVNLHKNLVKVAKDHNSLYSLHLLLWITVTFILLVGDSYIVMYVFFFHL 281


>AM292381-1|CAL23193.2|  364|Tribolium castaneum gustatory receptor
           candidate 60 protein.
          Length = 364

 Score = 20.6 bits (41), Expect = 9.4
 Identities = 7/18 (38%), Positives = 10/18 (55%)
 Frame = -1

Query: 240 VTLYTRPVFPWYTLCGIP 187
           V L    +  WYT+C +P
Sbjct: 9   VNLGLNGLIDWYTVCLVP 26


>AJ415419-1|CAC94468.1|  441|Tribolium castaneum transcription
           factor protein.
          Length = 441

 Score = 20.6 bits (41), Expect = 9.4
 Identities = 7/19 (36%), Positives = 11/19 (57%)
 Frame = +1

Query: 385 EGSQGCRQDRQPEETASSP 441
           +G  G  Q   PE ++S+P
Sbjct: 413 DGGSGQNQPESPESSSSTP 431


>AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like
           protein protein.
          Length = 1156

 Score = 20.6 bits (41), Expect = 9.4
 Identities = 11/44 (25%), Positives = 14/44 (31%)
 Frame = +1

Query: 130 ESVQSWRHCRHQRQWCSSKGYATQSIPWKDRSRVQRDCSCSRCD 261
           E + SWR     +      G      P    S V    +C  CD
Sbjct: 511 EQIISWRSSDDAKGGGGGSGSGNNQPPGGPSSHVSAVLTCKVCD 554


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 124,761
Number of Sequences: 336
Number of extensions: 2510
Number of successful extensions: 11
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 11
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11
length of database: 122,585
effective HSP length: 53
effective length of database: 104,777
effective search space used: 13516233
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -