SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B01
         (653 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292339-1|CAL23151.2|  387|Tribolium castaneum gustatory recept...    25   0.41 
AM292338-1|CAL23150.2|  372|Tribolium castaneum gustatory recept...    25   0.41 
AM292373-1|CAL23185.2|  360|Tribolium castaneum gustatory recept...    22   5.1  
AM292353-1|CAL23165.2|  651|Tribolium castaneum gustatory recept...    22   5.1  
DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro...    21   6.7  

>AM292339-1|CAL23151.2|  387|Tribolium castaneum gustatory receptor
           candidate 18 protein.
          Length = 387

 Score = 25.4 bits (53), Expect = 0.41
 Identities = 8/18 (44%), Positives = 12/18 (66%)
 Frame = +3

Query: 312 PLPYIINFKKNCRKWCRN 365
           PLP +++  KNC  +C N
Sbjct: 272 PLPIVLSIVKNCLSYCFN 289


>AM292338-1|CAL23150.2|  372|Tribolium castaneum gustatory receptor
           candidate 17 protein.
          Length = 372

 Score = 25.4 bits (53), Expect = 0.41
 Identities = 8/18 (44%), Positives = 12/18 (66%)
 Frame = +3

Query: 312 PLPYIINFKKNCRKWCRN 365
           PLP +++  KNC  +C N
Sbjct: 272 PLPIVLSIVKNCLSYCFN 289


>AM292373-1|CAL23185.2|  360|Tribolium castaneum gustatory receptor
           candidate 52 protein.
          Length = 360

 Score = 21.8 bits (44), Expect = 5.1
 Identities = 7/16 (43%), Positives = 10/16 (62%)
 Frame = +3

Query: 45  IIFYFWYLIRNNWNIF 92
           I+  FWY +  + NIF
Sbjct: 262 IVVIFWYTVNASTNIF 277


>AM292353-1|CAL23165.2|  651|Tribolium castaneum gustatory receptor
           candidate 32 protein.
          Length = 651

 Score = 21.8 bits (44), Expect = 5.1
 Identities = 7/16 (43%), Positives = 10/16 (62%)
 Frame = +3

Query: 45  IIFYFWYLIRNNWNIF 92
           I+  FWY +  + NIF
Sbjct: 262 IVVIFWYTVNASTNIF 277


>DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein.
          Length = 2700

 Score = 21.4 bits (43), Expect = 6.7
 Identities = 13/38 (34%), Positives = 21/38 (55%), Gaps = 2/38 (5%)
 Frame = -1

Query: 644  VFKFRSVNN--IVIAPGKTGSDNNNKNAVIPTAHTNKG 537
            V+ F  +N   ++I P  T +D +NK     TA+ +KG
Sbjct: 1856 VYGFAVLNGDQLIIKPHDTWADFDNKFYEKVTAYKSKG 1893


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 115,642
Number of Sequences: 336
Number of extensions: 1987
Number of successful extensions: 5
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 16865010
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -