SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A23
         (527 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY362544-1|AAQ63456.1|  268|Tribolium castaneum chitin synthase ...    24   0.72 
AY362543-1|AAQ63455.1|  677|Tribolium castaneum chitin synthase ...    24   0.72 
AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ...    24   0.72 
AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ...    24   0.72 
AF225975-2|AAF74116.1|  302|Tribolium castaneum Tc-tailless prot...    21   6.7  
EU019712-1|ABU25224.1|  535|Tribolium castaneum chitin deacetyla...    21   8.9  
AF219117-1|AAF71999.1|  406|Tribolium castaneum tailless ortholo...    21   8.9  

>AY362544-1|AAQ63456.1|  268|Tribolium castaneum chitin synthase
           protein.
          Length = 268

 Score = 24.2 bits (50), Expect = 0.72
 Identities = 11/32 (34%), Positives = 20/32 (62%)
 Frame = -2

Query: 346 KALRAILPDDLQKCEGVTPLRLRPPKILVTVF 251
           ++L +I+ +   K  G T +R+RPPK+  T +
Sbjct: 63  ESLASIIDEAATKVHGTT-VRVRPPKVYPTPY 93


>AY362543-1|AAQ63455.1|  677|Tribolium castaneum chitin synthase
           protein.
          Length = 677

 Score = 24.2 bits (50), Expect = 0.72
 Identities = 11/32 (34%), Positives = 20/32 (62%)
 Frame = -2

Query: 346 KALRAILPDDLQKCEGVTPLRLRPPKILVTVF 251
           ++L +I+ +   K  G T +R+RPPK+  T +
Sbjct: 377 ESLASIIDEAATKVHGTT-VRVRPPKVYPTPY 407


>AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase
           protein.
          Length = 1464

 Score = 24.2 bits (50), Expect = 0.72
 Identities = 11/32 (34%), Positives = 20/32 (62%)
 Frame = -2

Query: 346 KALRAILPDDLQKCEGVTPLRLRPPKILVTVF 251
           ++L +I+ +   K  G T +R+RPPK+  T +
Sbjct: 610 ESLASIIDEAATKVHGTT-VRVRPPKVYPTPY 640


>AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase
           CHS2 protein.
          Length = 1464

 Score = 24.2 bits (50), Expect = 0.72
 Identities = 11/32 (34%), Positives = 20/32 (62%)
 Frame = -2

Query: 346 KALRAILPDDLQKCEGVTPLRLRPPKILVTVF 251
           ++L +I+ +   K  G T +R+RPPK+  T +
Sbjct: 610 ESLASIIDEAATKVHGTT-VRVRPPKVYPTPY 640


>AF225975-2|AAF74116.1|  302|Tribolium castaneum Tc-tailless
           protein.
          Length = 302

 Score = 21.0 bits (42), Expect = 6.7
 Identities = 9/22 (40%), Positives = 10/22 (45%)
 Frame = -2

Query: 307 CEGVTPLRLRPPKILVTVFTPT 242
           C    PL   PP  L  +F PT
Sbjct: 171 CNNYLPLPQVPPLPLPPIFAPT 192


>EU019712-1|ABU25224.1|  535|Tribolium castaneum chitin deacetylase
           2A protein.
          Length = 535

 Score = 20.6 bits (41), Expect = 8.9
 Identities = 9/21 (42%), Positives = 11/21 (52%)
 Frame = +2

Query: 8   FFRLPTQGKMRSVTVKDVEQD 70
           +FRL T+G  R V   D   D
Sbjct: 42  YFRLTTEGDCRDVVRCDKNSD 62


>AF219117-1|AAF71999.1|  406|Tribolium castaneum tailless ortholog
           protein.
          Length = 406

 Score = 20.6 bits (41), Expect = 8.9
 Identities = 9/22 (40%), Positives = 10/22 (45%)
 Frame = -2

Query: 307 CEGVTPLRLRPPKILVTVFTPT 242
           C    PL   PP  L  +F PT
Sbjct: 171 CNNYPPLPQVPPLPLPPIFPPT 192


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 119,605
Number of Sequences: 336
Number of extensions: 2547
Number of successful extensions: 7
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 122,585
effective HSP length: 53
effective length of database: 104,777
effective search space used: 12782794
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -