SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A21
         (651 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292382-1|CAL23194.2|  670|Tribolium castaneum gustatory recept...    24   1.2  
AM292377-1|CAL23189.2|  358|Tribolium castaneum gustatory recept...    22   3.8  
AM292342-1|CAL23154.2|  386|Tribolium castaneum gustatory recept...    22   3.8  
AM292351-1|CAL23163.2|  394|Tribolium castaneum gustatory recept...    21   8.8  
AM292350-1|CAL23162.2|  429|Tribolium castaneum gustatory recept...    21   8.8  
AM292328-1|CAL23140.2|  429|Tribolium castaneum gustatory recept...    21   8.8  

>AM292382-1|CAL23194.2|  670|Tribolium castaneum gustatory receptor
           candidate 61 protein.
          Length = 670

 Score = 23.8 bits (49), Expect = 1.2
 Identities = 12/45 (26%), Positives = 22/45 (48%)
 Frame = -1

Query: 186 CDIINIVNNAIYFILPLLQIIHFSDGIDVH*YF*IKFSLRPFANV 52
           CD+ + VN    FI+ +  +I F+  +    Y     S+RP + +
Sbjct: 524 CDVCDSVNRIFGFIIIIGCLIQFNTIVFAFCYCYYSISIRPISTL 568


>AM292377-1|CAL23189.2|  358|Tribolium castaneum gustatory receptor
           candidate 56 protein.
          Length = 358

 Score = 22.2 bits (45), Expect = 3.8
 Identities = 8/23 (34%), Positives = 15/23 (65%)
 Frame = +1

Query: 148 EVYSIINDINYIAGVFGASVYNL 216
           +VY+ I+ + Y+   FG + Y+L
Sbjct: 15  DVYTAIHPLFYVCTFFGLAPYSL 37


>AM292342-1|CAL23154.2|  386|Tribolium castaneum gustatory receptor
           candidate 21 protein.
          Length = 386

 Score = 22.2 bits (45), Expect = 3.8
 Identities = 8/23 (34%), Positives = 15/23 (65%)
 Frame = +1

Query: 148 EVYSIINDINYIAGVFGASVYNL 216
           +VY+ I+ + Y+   FG + Y+L
Sbjct: 15  DVYTAIHPLFYVCTFFGLAPYSL 37


>AM292351-1|CAL23163.2|  394|Tribolium castaneum gustatory receptor
           candidate 30 protein.
          Length = 394

 Score = 21.0 bits (42), Expect = 8.8
 Identities = 6/24 (25%), Positives = 15/24 (62%)
 Frame = -2

Query: 89  FELNSVYDRSRMYFKNKSRAQSVW 18
           +    V DR++   ++K++++S W
Sbjct: 243 YRFTQVTDRTQSMSESKNKSESAW 266


>AM292350-1|CAL23162.2|  429|Tribolium castaneum gustatory receptor
           candidate 29 protein.
          Length = 429

 Score = 21.0 bits (42), Expect = 8.8
 Identities = 6/24 (25%), Positives = 15/24 (62%)
 Frame = -2

Query: 89  FELNSVYDRSRMYFKNKSRAQSVW 18
           +    V DR++   ++K++++S W
Sbjct: 243 YRFTQVTDRTQSMSESKNKSESAW 266


>AM292328-1|CAL23140.2|  429|Tribolium castaneum gustatory receptor
           candidate 7 protein.
          Length = 429

 Score = 21.0 bits (42), Expect = 8.8
 Identities = 6/24 (25%), Positives = 15/24 (62%)
 Frame = -2

Query: 89  FELNSVYDRSRMYFKNKSRAQSVW 18
           +    V DR++   ++K++++S W
Sbjct: 243 YRFTQVTDRTQSMSESKNKSESAW 266


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 103,395
Number of Sequences: 336
Number of extensions: 1524
Number of successful extensions: 6
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 16760905
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -