SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A19
         (601 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF592536-1|ABQ95982.1|  598|Tribolium castaneum beta-N-acetylglu...    25   0.37 
DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad...    24   1.1  
X97819-1|CAA66399.1|  251|Tribolium castaneum ZEN Tc protein.          23   2.0  
AM292339-1|CAL23151.2|  387|Tribolium castaneum gustatory recept...    23   2.0  
AM292338-1|CAL23150.2|  372|Tribolium castaneum gustatory recept...    23   2.0  
AM292364-1|CAL23176.2|  353|Tribolium castaneum gustatory recept...    23   2.6  
X91618-1|CAA62821.1|  524|Tribolium castaneum hunchback protein.       22   4.6  
EU008544-1|ABS31131.1|  493|Tribolium castaneum cytochrome P450 ...    22   4.6  
AJ606487-1|CAE55183.1|  203|Tribolium castaneum Giant protein pr...    21   6.0  
AF217810-1|AAF71998.1|  431|Tribolium castaneum fork head orthol...    21   7.9  

>EF592536-1|ABQ95982.1|  598|Tribolium castaneum
           beta-N-acetylglucosaminidase NAG1 protein.
          Length = 598

 Score = 25.4 bits (53), Expect = 0.37
 Identities = 21/63 (33%), Positives = 27/63 (42%), Gaps = 5/63 (7%)
 Frame = -2

Query: 522 SINSRRVPGLTFNTVLQRCVNRRTDGHRGQV---VASDLSMKTG--NLTINALQVTNKLS 358
           +INS    GLTF T   + +   T   R Q+   V   L +  G   L IN   +   L 
Sbjct: 81  NINSINTGGLTFETAAHKIMAGATKRFRNQIEALVPRKLRLADGGKTLEINYKLIDPDLK 140

Query: 357 ELN 349
           ELN
Sbjct: 141 ELN 143


>DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome
           adhesion molecule splicevariant 3.12.3.1 protein.
          Length = 1639

 Score = 23.8 bits (49), Expect = 1.1
 Identities = 9/19 (47%), Positives = 14/19 (73%)
 Frame = -2

Query: 420 DLSMKTGNLTINALQVTNK 364
           D+ ++ G LTIN +Q TN+
Sbjct: 752 DIKVEDGTLTINNIQKTNE 770


>X97819-1|CAA66399.1|  251|Tribolium castaneum ZEN Tc protein.
          Length = 251

 Score = 23.0 bits (47), Expect = 2.0
 Identities = 13/35 (37%), Positives = 17/35 (48%)
 Frame = +2

Query: 353 NSLSLFVTWRALMVRLPVFILKSEATTCPLCPSVL 457
           N  S  + W AL  +  VFI K       +CPS+L
Sbjct: 218 NQCSGTIDW-ALPNKRTVFIRKGGTAKASMCPSLL 251


>AM292339-1|CAL23151.2|  387|Tribolium castaneum gustatory receptor
           candidate 18 protein.
          Length = 387

 Score = 23.0 bits (47), Expect = 2.0
 Identities = 6/14 (42%), Positives = 12/14 (85%)
 Frame = +3

Query: 540 TCIYFTNQYLYYLI 581
           TCIY T+ Y+++++
Sbjct: 42  TCIYLTSLYIWFIL 55


>AM292338-1|CAL23150.2|  372|Tribolium castaneum gustatory receptor
           candidate 17 protein.
          Length = 372

 Score = 23.0 bits (47), Expect = 2.0
 Identities = 6/14 (42%), Positives = 12/14 (85%)
 Frame = +3

Query: 540 TCIYFTNQYLYYLI 581
           TCIY T+ Y+++++
Sbjct: 42  TCIYLTSLYIWFIL 55


>AM292364-1|CAL23176.2|  353|Tribolium castaneum gustatory receptor
           candidate 43 protein.
          Length = 353

 Score = 22.6 bits (46), Expect = 2.6
 Identities = 11/25 (44%), Positives = 14/25 (56%)
 Frame = +3

Query: 507 FYC*WSVEILKTCIYFTNQYLYYLI 581
           F C  +VE  +  I+F  Q L YLI
Sbjct: 146 FLCRHTVEYFQNYIHFFYQLLLYLI 170


>X91618-1|CAA62821.1|  524|Tribolium castaneum hunchback protein.
          Length = 524

 Score = 21.8 bits (44), Expect = 4.6
 Identities = 10/34 (29%), Positives = 16/34 (47%)
 Frame = +2

Query: 404 VFILKSEATTCPLCPSVLLLTHLCKTVLKVRPGT 505
           V I + +  TCP CP +    H  +  L+   G+
Sbjct: 223 VHIREDKRLTCPKCPFITEYKHHLEYHLRNHAGS 256


>EU008544-1|ABS31131.1|  493|Tribolium castaneum cytochrome P450
           protein.
          Length = 493

 Score = 21.8 bits (44), Expect = 4.6
 Identities = 7/18 (38%), Positives = 12/18 (66%)
 Frame = +3

Query: 519 WSVEILKTCIYFTNQYLY 572
           +SV+I+ TC +  N Y +
Sbjct: 173 YSVDIISTCAFGINTYCF 190


>AJ606487-1|CAE55183.1|  203|Tribolium castaneum Giant protein
           protein.
          Length = 203

 Score = 21.4 bits (43), Expect = 6.0
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +2

Query: 122 KTCRPLKAY 148
           K+CRP KAY
Sbjct: 66  KSCRPFKAY 74


>AF217810-1|AAF71998.1|  431|Tribolium castaneum fork head
           orthologue protein.
          Length = 431

 Score = 21.0 bits (42), Expect = 7.9
 Identities = 12/41 (29%), Positives = 15/41 (36%)
 Frame = +1

Query: 313 KHHGFNNSREGIVQFTQLIRDLESIDGEVARLHTQIRSHYL 435
           +HH  N S E +         L       A LH    SH+L
Sbjct: 316 QHHQQNMSHEELSAMVNRCHPLSLSSDHQAMLHHNPMSHHL 356


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 136,218
Number of Sequences: 336
Number of extensions: 2842
Number of successful extensions: 16
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 16
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 16
length of database: 122,585
effective HSP length: 54
effective length of database: 104,441
effective search space used: 15143945
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -