SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A18
         (487 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ211693-1|ABB16909.1|  314|Tribolium castaneum dorsocross protein.    22   2.6  
AY362543-1|AAQ63455.1|  677|Tribolium castaneum chitin synthase ...    22   3.4  
AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ...    22   3.4  
AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ...    22   3.4  
EF222294-1|ABN79654.1|  451|Tribolium castaneum ecdysis triggeri...    21   4.5  
EF222293-1|ABN79653.1|  434|Tribolium castaneum ecdysis triggeri...    21   4.5  

>DQ211693-1|ABB16909.1|  314|Tribolium castaneum dorsocross protein.
          Length = 314

 Score = 22.2 bits (45), Expect = 2.6
 Identities = 9/10 (90%), Positives = 9/10 (90%)
 Frame = +1

Query: 124 YQYVKKPKKI 153
           YQ VKKPKKI
Sbjct: 292 YQEVKKPKKI 301


>AY362543-1|AAQ63455.1|  677|Tribolium castaneum chitin synthase
           protein.
          Length = 677

 Score = 21.8 bits (44), Expect = 3.4
 Identities = 19/76 (25%), Positives = 34/76 (44%)
 Frame = -2

Query: 324 LFFNEEGSDNALLDTFMAEDTTINTFHCFLTVAKTGTFSRSSWLDTTEFALALTTPWDLL 145
           +F+ +EGS + L D F A     N     +     G ++ +S + +      + T   + 
Sbjct: 74  IFYCQEGSVDFLFDNFSAAFQDHNIEITEVAPVLPGNYANASSVGSRN---PIHTSSYMT 130

Query: 144 GLFYILINQAATRCPY 97
           G++  LIN +AT   Y
Sbjct: 131 GIWVWLINISATYICY 146


>AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase
           protein.
          Length = 1464

 Score = 21.8 bits (44), Expect = 3.4
 Identities = 19/76 (25%), Positives = 34/76 (44%)
 Frame = -2

Query: 324 LFFNEEGSDNALLDTFMAEDTTINTFHCFLTVAKTGTFSRSSWLDTTEFALALTTPWDLL 145
           +F+ +EGS + L D F A     N     +     G ++ +S + +      + T   + 
Sbjct: 307 IFYCQEGSVDFLFDNFSAAFQDHNIEITEVAPVLPGNYANASSVGSRN---PIHTSSYMT 363

Query: 144 GLFYILINQAATRCPY 97
           G++  LIN +AT   Y
Sbjct: 364 GIWVWLINISATYICY 379


>AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase
           CHS2 protein.
          Length = 1464

 Score = 21.8 bits (44), Expect = 3.4
 Identities = 19/76 (25%), Positives = 34/76 (44%)
 Frame = -2

Query: 324 LFFNEEGSDNALLDTFMAEDTTINTFHCFLTVAKTGTFSRSSWLDTTEFALALTTPWDLL 145
           +F+ +EGS + L D F A     N     +     G ++ +S + +      + T   + 
Sbjct: 307 IFYCQEGSVDFLFDNFSAAFQDHNIEITEVAPVLPGNYANASSVGSRN---PIHTSSYMT 363

Query: 144 GLFYILINQAATRCPY 97
           G++  LIN +AT   Y
Sbjct: 364 GIWVWLINISATYICY 379


>EF222294-1|ABN79654.1|  451|Tribolium castaneum ecdysis triggering
           hormone receptorisoform B protein.
          Length = 451

 Score = 21.4 bits (43), Expect = 4.5
 Identities = 11/38 (28%), Positives = 17/38 (44%)
 Frame = +3

Query: 24  LENGAAAYIQATTVVQHKIKSKKNSKDTGWPLGLSVCK 137
           L N + A +    V    +  + NS+   W LG  +CK
Sbjct: 107 LVNLSVADLMVLLVCTPTVLVEVNSRPETWVLGREMCK 144


>EF222293-1|ABN79653.1|  434|Tribolium castaneum ecdysis triggering
           hormone receptorisoform A protein.
          Length = 434

 Score = 21.4 bits (43), Expect = 4.5
 Identities = 11/38 (28%), Positives = 17/38 (44%)
 Frame = +3

Query: 24  LENGAAAYIQATTVVQHKIKSKKNSKDTGWPLGLSVCK 137
           L N + A +    V    +  + NS+   W LG  +CK
Sbjct: 107 LVNLSVADLMVLLVCTPTVLVEVNSRPETWVLGREMCK 144


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 96,723
Number of Sequences: 336
Number of extensions: 2094
Number of successful extensions: 7
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 122,585
effective HSP length: 53
effective length of database: 104,777
effective search space used: 11315916
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)

- SilkBase 1999-2022 -