SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A17
         (656 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF592538-1|ABQ95984.1|  582|Tribolium castaneum beta-N-acetylglu...    23   2.2  
EF222299-1|ABN79659.1|  136|Tribolium castaneum ion transport pe...    23   2.2  
EF222298-1|ABN79658.1|  120|Tribolium castaneum ion transport pe...    23   2.2  
EF222297-1|ABN79657.1|  140|Tribolium castaneum ion transport pe...    23   2.2  
AY531877-1|AAT08872.1|  247|Tribolium castaneum ORF1p protein.         22   3.9  
DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro...    21   6.7  
AY884065-1|AAX84206.1|  697|Tribolium castaneum laccase 1 protein.     21   6.7  
AM295015-1|CAL25730.1|  549|Tribolium castaneum ecdysone recepto...    21   6.7  
AF321227-6|AAK16426.1|  150|Tribolium castaneum Pb protein.            21   6.7  
AM292372-1|CAL23184.2|  771|Tribolium castaneum gustatory recept...    21   8.9  
AF217810-1|AAF71998.1|  431|Tribolium castaneum fork head orthol...    21   8.9  

>EF592538-1|ABQ95984.1|  582|Tribolium castaneum
           beta-N-acetylglucosaminidase NAG3 protein.
          Length = 582

 Score = 23.0 bits (47), Expect = 2.2
 Identities = 12/41 (29%), Positives = 18/41 (43%), Gaps = 1/41 (2%)
 Frame = -1

Query: 305 KLACVEPFGSNEELLPCLELVWIAEVYNSQRCT-STRVMDY 186
           +L+    FG+   L    +L+W  EV N  R      + DY
Sbjct: 173 RLSAANFFGARHGLETLNQLIWFDEVVNELRILHGVEIRDY 213


>EF222299-1|ABN79659.1|  136|Tribolium castaneum ion transport
           peptide isoform C protein.
          Length = 136

 Score = 23.0 bits (47), Expect = 2.2
 Identities = 11/27 (40%), Positives = 16/27 (59%)
 Frame = +1

Query: 244 TSSRQGRSSSLLPKGSTQANLFIVERK 324
           TSS  GRS + LP   T+ + F ++ K
Sbjct: 28  TSSPAGRSPAFLPHHFTKRSFFDIQCK 54


>EF222298-1|ABN79658.1|  120|Tribolium castaneum ion transport
           peptide isoform B protein.
          Length = 120

 Score = 23.0 bits (47), Expect = 2.2
 Identities = 11/27 (40%), Positives = 16/27 (59%)
 Frame = +1

Query: 244 TSSRQGRSSSLLPKGSTQANLFIVERK 324
           TSS  GRS + LP   T+ + F ++ K
Sbjct: 28  TSSPAGRSPAFLPHHFTKRSFFDIQCK 54


>EF222297-1|ABN79657.1|  140|Tribolium castaneum ion transport
           peptide isoform A protein.
          Length = 140

 Score = 23.0 bits (47), Expect = 2.2
 Identities = 11/27 (40%), Positives = 16/27 (59%)
 Frame = +1

Query: 244 TSSRQGRSSSLLPKGSTQANLFIVERK 324
           TSS  GRS + LP   T+ + F ++ K
Sbjct: 28  TSSPAGRSPAFLPHHFTKRSFFDIQCK 54


>AY531877-1|AAT08872.1|  247|Tribolium castaneum ORF1p protein.
          Length = 247

 Score = 22.2 bits (45), Expect = 3.9
 Identities = 14/37 (37%), Positives = 18/37 (48%)
 Frame = +3

Query: 336 VGNVMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFA 446
           VG  +      EG     L E +GD G+L  AS +FA
Sbjct: 91  VGTALTFCLQEEGGTTSQLIELLGDAGKLL-ASVHFA 126


>DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein.
          Length = 2700

 Score = 21.4 bits (43), Expect = 6.7
 Identities = 5/11 (45%), Positives = 7/11 (63%)
 Frame = +2

Query: 434  WKLRHCDWTQS 466
            W   HCDW ++
Sbjct: 2271 WNKDHCDWPEN 2281


>AY884065-1|AAX84206.1|  697|Tribolium castaneum laccase 1 protein.
          Length = 697

 Score = 21.4 bits (43), Expect = 6.7
 Identities = 7/13 (53%), Positives = 9/13 (69%)
 Frame = -2

Query: 514 TFLAPDGSFTLVR 476
           T   PDG FT++R
Sbjct: 579 TVTVPDGGFTIIR 591


>AM295015-1|CAL25730.1|  549|Tribolium castaneum ecdysone receptor
           (isoform A) protein.
          Length = 549

 Score = 21.4 bits (43), Expect = 6.7
 Identities = 12/38 (31%), Positives = 21/38 (55%)
 Frame = +3

Query: 459 HNPDAKRTRVKLPSGAKKVLPSSNRGMVGIVAGGGRID 572
           H+P A  +   LP+GA   L  ++ G+V  +A G  ++
Sbjct: 35  HSPCATGSN-GLPAGAGSNLLCASNGLVTTLASGSSLN 71


>AF321227-6|AAK16426.1|  150|Tribolium castaneum Pb protein.
          Length = 150

 Score = 21.4 bits (43), Expect = 6.7
 Identities = 10/31 (32%), Positives = 14/31 (45%)
 Frame = +1

Query: 217 WLLYTSAIHTSSRQGRSSSLLPKGSTQANLF 309
           W+        SS+QG        G+T AN+F
Sbjct: 117 WMKEKKTTRKSSQQGNFEFRNTVGATTANIF 147


>AM292372-1|CAL23184.2|  771|Tribolium castaneum gustatory receptor
           candidate 51 protein.
          Length = 771

 Score = 21.0 bits (42), Expect = 8.9
 Identities = 11/36 (30%), Positives = 18/36 (50%)
 Frame = +3

Query: 249 FKTRKELFIAPEGLYTGQFVYCGKKATLEVGNVMPV 356
           FK      +  + L+T +F +    ATL V N++ V
Sbjct: 455 FKNENLSEMVKQFLFTQKFTFVAGLATLSVLNLLSV 490


>AF217810-1|AAF71998.1|  431|Tribolium castaneum fork head
           orthologue protein.
          Length = 431

 Score = 21.0 bits (42), Expect = 8.9
 Identities = 15/45 (33%), Positives = 19/45 (42%)
 Frame = -1

Query: 383 HNGTLRHSSNRHHISNFKSCFLSTINKLACVEPFGSNEELLPCLE 249
           H   L H+   HH+    S F S+ +      PF  N  LLP  E
Sbjct: 343 HQAMLHHNPMSHHLKQEPSGFTSSNH------PFSIN-RLLPTAE 380


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 165,220
Number of Sequences: 336
Number of extensions: 3691
Number of successful extensions: 14
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 14
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 14
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 16969115
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -