SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A11
         (457 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ005083-1|CAB65469.1|  585|Tribolium castaneum signal receptor ...    23   1.8  
AY920544-1|AAX62142.1|  463|Tribolium castaneum cytochrome P450 ...    21   4.1  
AM292376-1|CAL23188.2|  402|Tribolium castaneum gustatory recept...    20   9.5  
AM292332-1|CAL23144.2|  344|Tribolium castaneum gustatory recept...    20   9.5  

>AJ005083-1|CAB65469.1|  585|Tribolium castaneum signal receptor
           protein protein.
          Length = 585

 Score = 22.6 bits (46), Expect = 1.8
 Identities = 12/37 (32%), Positives = 20/37 (54%)
 Frame = +3

Query: 258 VVSPNPSSKRRQKPLRKLCSVLSVQIAR*DHRLH*RD 368
           +VS   ++ R+  PL+KLC+  + +     HR H  D
Sbjct: 138 MVSCKDAALRKVVPLKKLCNNGTCEDIGNSHRCHCSD 174


>AY920544-1|AAX62142.1|  463|Tribolium castaneum cytochrome P450
           monooxygenase protein.
          Length = 463

 Score = 21.4 bits (43), Expect = 4.1
 Identities = 10/37 (27%), Positives = 16/37 (43%)
 Frame = -2

Query: 417 IICPFLFLSPPSSKCLHLFNATCDLTLQSAHSRRSTI 307
           ++C  L L PP+ +   L N    +     H R  T+
Sbjct: 334 VVCESLRLWPPAPQTDRLCNKNFVIEASKPHERTFTV 370


>AM292376-1|CAL23188.2|  402|Tribolium castaneum gustatory receptor
           candidate 55 protein.
          Length = 402

 Score = 20.2 bits (40), Expect = 9.5
 Identities = 8/25 (32%), Positives = 13/25 (52%)
 Frame = -3

Query: 404 FSSCHHRAQSACISSMQPVISPCNL 330
           + + HH       +SM+PV + C L
Sbjct: 10  YFTTHHDTLHNIYTSMKPVYAICKL 34


>AM292332-1|CAL23144.2|  344|Tribolium castaneum gustatory receptor
           candidate 11 protein.
          Length = 344

 Score = 20.2 bits (40), Expect = 9.5
 Identities = 8/25 (32%), Positives = 13/25 (52%)
 Frame = -3

Query: 404 FSSCHHRAQSACISSMQPVISPCNL 330
           + + HH       +SM+PV + C L
Sbjct: 10  YFTTHHDTLHNIYTSMKPVYAICKL 34


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 104,199
Number of Sequences: 336
Number of extensions: 2152
Number of successful extensions: 4
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 122,585
effective HSP length: 52
effective length of database: 105,113
effective search space used: 10406187
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)

- SilkBase 1999-2022 -