SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A10
         (653 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ855492-1|ABH88179.1|  251|Tribolium castaneum chemosensory pro...    25   0.54 
AY074761-1|AAL71874.1|  314|Tribolium castaneum ultrabithorax pr...    23   1.7  
AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept...    23   1.7  
AF146649-1|AAD38009.1|   96|Tribolium castaneum ultrathorax prot...    23   1.7  
AM712901-1|CAN84640.1|  205|Tribolium castaneum hypothetical pro...    21   6.7  
AJ415419-1|CAC94468.1|  441|Tribolium castaneum transcription fa...    21   8.9  

>DQ855492-1|ABH88179.1|  251|Tribolium castaneum chemosensory
           protein 6 protein.
          Length = 251

 Score = 25.0 bits (52), Expect = 0.54
 Identities = 10/20 (50%), Positives = 14/20 (70%)
 Frame = +1

Query: 244 PDVVFVFGFKTNFGGGKSTG 303
           PD VF+  F+T+F  GK +G
Sbjct: 107 PDDVFIRKFETSFESGKPSG 126


>AY074761-1|AAL71874.1|  314|Tribolium castaneum ultrabithorax
           protein.
          Length = 314

 Score = 23.4 bits (48), Expect = 1.7
 Identities = 15/48 (31%), Positives = 23/48 (47%), Gaps = 7/48 (14%)
 Frame = +1

Query: 316 YDTLDLAKKFEPKHRLAR-------HGLYEKKRPTRKQRKERKNRMKK 438
           Y TL+L K+F   H L R       H L   +R  +   + R+ ++KK
Sbjct: 233 YQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKK 280


>AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor
           candidate 46 protein.
          Length = 1451

 Score = 23.4 bits (48), Expect = 1.7
 Identities = 12/36 (33%), Positives = 18/36 (50%)
 Frame = -3

Query: 510 IHLYLAFTSLLGGRTYFRFLGTADLLHSVLTFFTLF 403
           IHL++    L+G + +        L HSV  F T+F
Sbjct: 778 IHLFVKCVFLMGYQIFDWVQKEQSLAHSVGVFLTIF 813


>AF146649-1|AAD38009.1|   96|Tribolium castaneum ultrathorax
           protein.
          Length = 96

 Score = 23.4 bits (48), Expect = 1.7
 Identities = 15/48 (31%), Positives = 23/48 (47%), Gaps = 7/48 (14%)
 Frame = +1

Query: 316 YDTLDLAKKFEPKHRLAR-------HGLYEKKRPTRKQRKERKNRMKK 438
           Y TL+L K+F   H L R       H L   +R  +   + R+ ++KK
Sbjct: 15  YQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKK 62


>AM712901-1|CAN84640.1|  205|Tribolium castaneum hypothetical
           protein protein.
          Length = 205

 Score = 21.4 bits (43), Expect = 6.7
 Identities = 9/28 (32%), Positives = 15/28 (53%)
 Frame = +3

Query: 96  RNSDYSHSQVHDQQIVGAQADGLRCFTS 179
           R  DY +  + DQ +V    +G+R  +S
Sbjct: 178 RCKDYKNEDLEDQPVVYNDVNGVRINSS 205


>AJ415419-1|CAC94468.1|  441|Tribolium castaneum transcription
           factor protein.
          Length = 441

 Score = 21.0 bits (42), Expect = 8.9
 Identities = 9/23 (39%), Positives = 14/23 (60%)
 Frame = +1

Query: 127 MTNRLLARKQMVCDVLHPGKPTV 195
           +TN+     Q++ + LH  KPTV
Sbjct: 134 LTNKSNGNGQIMLNSLHKYKPTV 156


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 153,818
Number of Sequences: 336
Number of extensions: 3551
Number of successful extensions: 7
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 16865010
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -