SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A09
         (627 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292357-1|CAL23169.2|  355|Tribolium castaneum gustatory recept...    24   1.2  
AF322227-1|AAK01654.1|  782|Tribolium castaneum cell surface pro...    23   1.6  
U09586-3|AAC47272.1|  470|Tribolium castaneum integrase protein.       23   2.8  
AM295016-1|CAL25731.1|   96|Tribolium castaneum ecdysone recepto...    21   8.4  

>AM292357-1|CAL23169.2|  355|Tribolium castaneum gustatory receptor
           candidate 36 protein.
          Length = 355

 Score = 23.8 bits (49), Expect = 1.2
 Identities = 12/48 (25%), Positives = 22/48 (45%)
 Frame = -3

Query: 583 IQLHFKLLTDCCMMVGIFTIL*LYYHLTSDFYNTNTIFCLAKAQNTGL 440
           +Q + K+ T C  +  ++ IL     + +D +    I  LAK   + L
Sbjct: 193 LQKYLKIETSCRYVGTLYRILTTMMEMVNDIFGWTLILILAKCITSSL 240


>AF322227-1|AAK01654.1|  782|Tribolium castaneum cell surface
           protein chaoptin protein.
          Length = 782

 Score = 23.4 bits (48), Expect = 1.6
 Identities = 13/29 (44%), Positives = 17/29 (58%)
 Frame = +1

Query: 58  TPRNS*RPQWLGYSNCN*SEIPGHDFIFV 144
           T RN+ + QWL  S+   SEIP   F F+
Sbjct: 291 TFRNTKKLQWLDTSHNRISEIPNDLFRFL 319


>U09586-3|AAC47272.1|  470|Tribolium castaneum integrase protein.
          Length = 470

 Score = 22.6 bits (46), Expect = 2.8
 Identities = 9/23 (39%), Positives = 13/23 (56%)
 Frame = +2

Query: 248 VLSSDGNYALSGSWDKTLRLWDL 316
           VLS  G   +S +W  +LR  D+
Sbjct: 260 VLSDHGTQFISNTWQNSLRAADI 282


>AM295016-1|CAL25731.1|   96|Tribolium castaneum ecdysone receptor
           (isoform B) protein.
          Length = 96

 Score = 21.0 bits (42), Expect = 8.4
 Identities = 13/39 (33%), Positives = 19/39 (48%), Gaps = 1/39 (2%)
 Frame = +2

Query: 173 LTRDENNYGIPQKRLYGHSHFISDVVLSS-DGNYALSGS 286
           LT  +N YG+P   +   +H ++    SS  G   LS S
Sbjct: 58  LTIIQNGYGLPGHTIIASNHHLAKSDTSSASGREDLSPS 96


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 142,384
Number of Sequences: 336
Number of extensions: 3060
Number of successful extensions: 7
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 122,585
effective HSP length: 54
effective length of database: 104,441
effective search space used: 16083914
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -