SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120043.Seq
         (810 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292370-1|CAL23182.1|  418|Tribolium castaneum gustatory recept...    27   0.13 
EF125547-1|ABL73931.1|  255|Tribolium castaneum obstractor D pro...    23   3.8  
EU019709-1|ABU25221.1|  540|Tribolium castaneum aspartate 1-deca...    22   5.0  
AM292335-1|CAL23147.2|  374|Tribolium castaneum gustatory recept...    22   5.0  
AM292324-1|CAL23136.1|  398|Tribolium castaneum gustatory recept...    22   5.0  
DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro...    21   8.8  
AJ307577-1|CAC84070.1|  301|Tribolium castaneum dachshund protein.     21   8.8  
AF322227-1|AAK01654.1|  782|Tribolium castaneum cell surface pro...    21   8.8  
AF263515-1|AAF74207.1|  126|Tribolium castaneum cytochrome P450 ...    21   8.8  

>AM292370-1|CAL23182.1|  418|Tribolium castaneum gustatory receptor
           candidate 49 protein.
          Length = 418

 Score = 27.5 bits (58), Expect = 0.13
 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 2/50 (4%)
 Frame = +2

Query: 227 DFYFVDVKIGAEIVFCKYNLLVGLCDKIDILPKRPL--IILYRVLTFLQF 370
           ++  +  K    +V  KY L+     K+ +LPK PL   +LY++L  +QF
Sbjct: 18  NYLILSNKNNTYLVLNKYLLVKHSKPKMPLLPKTPLPLTLLYKLLGIIQF 67


>EF125547-1|ABL73931.1|  255|Tribolium castaneum obstractor D
           protein.
          Length = 255

 Score = 22.6 bits (46), Expect = 3.8
 Identities = 9/16 (56%), Positives = 10/16 (62%)
 Frame = -3

Query: 247 NVDEIKVHQLMNDHPN 200
           NVD  + H L ND PN
Sbjct: 146 NVDGCQKHPLCNDDPN 161


>EU019709-1|ABU25221.1|  540|Tribolium castaneum aspartate
           1-decarboxylase protein.
          Length = 540

 Score = 22.2 bits (45), Expect = 5.0
 Identities = 8/26 (30%), Positives = 14/26 (53%)
 Frame = -3

Query: 226 HQLMNDHPNFIKIYFNHGFINNQVIV 149
           +Q    HPNF +I F +  ++   +V
Sbjct: 502 YQAQKGHPNFFRIVFQNSGLDKADMV 527


>AM292335-1|CAL23147.2|  374|Tribolium castaneum gustatory receptor
           candidate 14 protein.
          Length = 374

 Score = 22.2 bits (45), Expect = 5.0
 Identities = 10/21 (47%), Positives = 15/21 (71%), Gaps = 2/21 (9%)
 Frame = +2

Query: 314 ILPKRPL--IILYRVLTFLQF 370
           +LPK PL   +LY++L  +QF
Sbjct: 3   LLPKTPLPLTLLYKLLGIIQF 23


>AM292324-1|CAL23136.1|  398|Tribolium castaneum gustatory receptor
           candidate 3 protein.
          Length = 398

 Score = 22.2 bits (45), Expect = 5.0
 Identities = 8/22 (36%), Positives = 15/22 (68%)
 Frame = +2

Query: 437 NMNLYNLIYSIIGTIKLMHINF 502
           +++L ++ YS IGT+    +NF
Sbjct: 312 SIHLCDVCYSTIGTVSWCELNF 333


>DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10
           protein.
          Length = 2700

 Score = 21.4 bits (43), Expect = 8.8
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = +1

Query: 328 PVDYFIPSFDVF 363
           P+D + PSFD+F
Sbjct: 95  PIDDYEPSFDLF 106


>AJ307577-1|CAC84070.1|  301|Tribolium castaneum dachshund protein.
          Length = 301

 Score = 21.4 bits (43), Expect = 8.8
 Identities = 9/26 (34%), Positives = 12/26 (46%)
 Frame = -3

Query: 430 SSWPPPPPQMYAANAGTILRKLQKRQ 353
           SSWP  PP+            LQ++Q
Sbjct: 35  SSWPGRPPKRAPVGLSLAASHLQQQQ 60


>AF322227-1|AAK01654.1|  782|Tribolium castaneum cell surface
           protein chaoptin protein.
          Length = 782

 Score = 21.4 bits (43), Expect = 8.8
 Identities = 10/32 (31%), Positives = 16/32 (50%)
 Frame = -3

Query: 97  ELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           + SH  +S I   L   L +L   +F HN ++
Sbjct: 302 DTSHNRISEIPNDLFRFLGNLRIVDFSHNRLR 333


>AF263515-1|AAF74207.1|  126|Tribolium castaneum cytochrome P450
           monooxygenase protein.
          Length = 126

 Score = 21.4 bits (43), Expect = 8.8
 Identities = 9/22 (40%), Positives = 14/22 (63%), Gaps = 3/22 (13%)
 Frame = -3

Query: 454 IVQIHIYDSSWPP---PPPQMY 398
           I+Q+HIYD  + P   P P+ +
Sbjct: 86  ILQLHIYDLHYNPVIYPEPEKF 107


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 177,905
Number of Sequences: 336
Number of extensions: 3899
Number of successful extensions: 19
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 15
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 19
length of database: 122,585
effective HSP length: 56
effective length of database: 103,769
effective search space used: 22102797
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -