SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120035.Seq
         (749 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ659248-1|ABG47446.1|  496|Tribolium castaneum chitinase 8 prot...    24   1.5  
AM292340-1|CAL23152.1|  355|Tribolium castaneum gustatory recept...    23   2.6  
AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr...    23   2.6  
AM292372-1|CAL23184.2|  771|Tribolium castaneum gustatory recept...    23   3.4  
AF263515-1|AAF74207.1|  126|Tribolium castaneum cytochrome P450 ...    22   4.6  
AY337337-1|AAP94192.1|  505|Tribolium castaneum cytochrome P450 ...    22   6.0  
AM292343-1|CAL23155.2|  301|Tribolium castaneum gustatory recept...    22   6.0  
AF254755-1|AAF70496.1|  505|Tribolium castaneum cytochrome P450 ...    22   6.0  

>DQ659248-1|ABG47446.1|  496|Tribolium castaneum chitinase 8
           protein.
          Length = 496

 Score = 23.8 bits (49), Expect = 1.5
 Identities = 11/26 (42%), Positives = 13/26 (50%)
 Frame = +1

Query: 430 AAGTKRKLDEYLDDSQSVVGQFNKNK 507
           A G  R LDEYLD     + + N  K
Sbjct: 65  ADGNVRHLDEYLDVDAGTIAKLNALK 90


>AM292340-1|CAL23152.1|  355|Tribolium castaneum gustatory receptor
           candidate 19 protein.
          Length = 355

 Score = 23.0 bits (47), Expect = 2.6
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 533 CAFLVFRLHLFLL 495
           CAF++F +HL  L
Sbjct: 270 CAFIIFTMHLLFL 282



 Score = 22.6 bits (46), Expect = 3.4
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -1

Query: 533 CAFLVFRLHLFLL 495
           CAF++F +HL  L
Sbjct: 151 CAFIIFTVHLLFL 163



 Score = 21.8 bits (44), Expect = 6.0
 Identities = 7/13 (53%), Positives = 9/13 (69%)
 Frame = -1

Query: 533 CAFLVFRLHLFLL 495
           CAF+ F +HL  L
Sbjct: 184 CAFIFFNMHLLFL 196



 Score = 21.4 bits (43), Expect = 8.0
 Identities = 6/10 (60%), Positives = 9/10 (90%)
 Frame = -1

Query: 533 CAFLVFRLHL 504
           CAF++F +HL
Sbjct: 171 CAFIIFTMHL 180


>AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like
           protein protein.
          Length = 1156

 Score = 23.0 bits (47), Expect = 2.6
 Identities = 10/20 (50%), Positives = 14/20 (70%)
 Frame = -2

Query: 307 SEIISGLEQTFHYIVIISNE 248
           +E+ S ++QT HY  IIS E
Sbjct: 492 AEMTSHMQQTQHYTNIISQE 511


>AM292372-1|CAL23184.2|  771|Tribolium castaneum gustatory receptor
           candidate 51 protein.
          Length = 771

 Score = 22.6 bits (46), Expect = 3.4
 Identities = 13/37 (35%), Positives = 20/37 (54%), Gaps = 7/37 (18%)
 Frame = -1

Query: 581 VRVVINCLLKGCTALNCAFLV-------FRLHLFLLN 492
           + V+ +C L+  +ALN AFL        F + +FL N
Sbjct: 246 ILVIFDCCLETVSALNGAFLYTINGQGQFNIEMFLCN 282


>AF263515-1|AAF74207.1|  126|Tribolium castaneum cytochrome P450
           monooxygenase protein.
          Length = 126

 Score = 22.2 bits (45), Expect = 4.6
 Identities = 9/25 (36%), Positives = 12/25 (48%)
 Frame = +3

Query: 81  PTPSRASFDNGYSEFCDKQQPNDYL 155
           P P +   D    E CDK+ P  Y+
Sbjct: 102 PEPEKFDPDRFLPENCDKRHPYAYI 126


>AY337337-1|AAP94192.1|  505|Tribolium castaneum cytochrome P450
           monooxygenase protein.
          Length = 505

 Score = 21.8 bits (44), Expect = 6.0
 Identities = 10/31 (32%), Positives = 13/31 (41%)
 Frame = +3

Query: 81  PTPSRASFDNGYSEFCDKQQPNDYLNYYNNP 173
           P P +   D    E C K+ P  YL +   P
Sbjct: 418 PDPEKFDPDRFLPENCQKRHPFAYLPFSAGP 448


>AM292343-1|CAL23155.2|  301|Tribolium castaneum gustatory receptor
           candidate 22 protein.
          Length = 301

 Score = 21.8 bits (44), Expect = 6.0
 Identities = 8/15 (53%), Positives = 12/15 (80%)
 Frame = -3

Query: 228 LKLLQSRCQILPCRL 184
           LKL+Q++ +I  CRL
Sbjct: 248 LKLMQNKLEITACRL 262


>AF254755-1|AAF70496.1|  505|Tribolium castaneum cytochrome P450
           monooxigenase CYP4Q7 protein.
          Length = 505

 Score = 21.8 bits (44), Expect = 6.0
 Identities = 10/31 (32%), Positives = 13/31 (41%)
 Frame = +3

Query: 81  PTPSRASFDNGYSEFCDKQQPNDYLNYYNNP 173
           P P +   D    E C K+ P  YL +   P
Sbjct: 418 PDPEKFDPDRFLPENCQKRHPFAYLPFSAGP 448


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 169,549
Number of Sequences: 336
Number of extensions: 3774
Number of successful extensions: 14
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 11
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 14
length of database: 122,585
effective HSP length: 56
effective length of database: 103,769
effective search space used: 20027417
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -