SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120034X.Seq
         (582 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept...    23   1.9  
EF592539-1|ABQ95985.1|  630|Tribolium castaneum beta-N-acetylglu...    22   3.3  
DQ342040-1|ABC69932.1|  822|Tribolium castaneum STIP protein.          22   4.4  
AM292381-1|CAL23193.2|  364|Tribolium castaneum gustatory recept...    22   4.4  
EU008544-1|ABS31131.1|  493|Tribolium castaneum cytochrome P450 ...    21   5.8  
EF592538-1|ABQ95984.1|  582|Tribolium castaneum beta-N-acetylglu...    21   7.6  

>AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor
            candidate 46 protein.
          Length = 1451

 Score = 23.0 bits (47), Expect = 1.9
 Identities = 8/16 (50%), Positives = 13/16 (81%)
 Frame = -2

Query: 260  EHVLDLVGMLKRRFVL 213
            +H ++LV M+K RFV+
Sbjct: 1256 QHCVELVSMIKARFVV 1271


>EF592539-1|ABQ95985.1|  630|Tribolium castaneum
           beta-N-acetylglucosaminidase FDL protein.
          Length = 630

 Score = 22.2 bits (45), Expect = 3.3
 Identities = 8/18 (44%), Positives = 12/18 (66%), Gaps = 1/18 (5%)
 Frame = +1

Query: 109 TCSVMSSQSDLWPR-TSP 159
           TCS++   + LWP+ T P
Sbjct: 81  TCSMLCGSTQLWPQPTGP 98



 Score = 21.0 bits (42), Expect = 7.6
 Identities = 9/31 (29%), Positives = 16/31 (51%)
 Frame = +2

Query: 389 LLEEVIPQVLCTGKYAPAVEMDTNDVIAKID 481
           L+ + +PQ+   G Y P +     DV A ++
Sbjct: 284 LVSQRVPQLAKNGAYGPDMIYTPEDVKALVE 314


>DQ342040-1|ABC69932.1|  822|Tribolium castaneum STIP protein.
          Length = 822

 Score = 21.8 bits (44), Expect = 4.4
 Identities = 7/15 (46%), Positives = 9/15 (60%)
 Frame = +1

Query: 307 HSAHYQIWRDSTDNE 351
           H   Y IW D +DN+
Sbjct: 30  HQQIYGIWADDSDND 44


>AM292381-1|CAL23193.2|  364|Tribolium castaneum gustatory
          receptor candidate 60 protein.
          Length = 364

 Score = 21.8 bits (44), Expect = 4.4
 Identities = 7/14 (50%), Positives = 12/14 (85%)
 Frame = +2

Query: 2  VESPRVVVNKFNLI 43
          V+ PR+VV+ FN++
Sbjct: 36 VQYPRIVVSTFNIV 49


>EU008544-1|ABS31131.1|  493|Tribolium castaneum cytochrome P450
           protein.
          Length = 493

 Score = 21.4 bits (43), Expect = 5.8
 Identities = 8/20 (40%), Positives = 15/20 (75%)
 Frame = +2

Query: 503 VATQILRKQPIAHFVCQRND 562
           V ++ LRK P+A F+ +++D
Sbjct: 352 VISETLRKYPLAPFLNRKSD 371


>EF592538-1|ABQ95984.1|  582|Tribolium castaneum
           beta-N-acetylglucosaminidase NAG3 protein.
          Length = 582

 Score = 21.0 bits (42), Expect = 7.6
 Identities = 5/14 (35%), Positives = 11/14 (78%)
 Frame = +1

Query: 109 TCSVMSSQSDLWPR 150
           TC+++ S+  +WP+
Sbjct: 67  TCNMLCSEPAIWPK 80


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 145,997
Number of Sequences: 336
Number of extensions: 3346
Number of successful extensions: 11
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 10
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11
length of database: 122,585
effective HSP length: 54
effective length of database: 104,441
effective search space used: 14517299
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -