SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120031.Seq
         (726 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ...    27   0.15 
AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ...    27   0.15 
AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ...    27   0.15 
AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ...    27   0.15 
DQ855501-1|ABH88188.1|  146|Tribolium castaneum chemosensory pro...    27   0.20 
DQ855491-1|ABH88178.1|  144|Tribolium castaneum chemosensory pro...    23   1.9  
AY362543-1|AAQ63455.1|  677|Tribolium castaneum chitin synthase ...    22   4.4  
AM292369-1|CAL23181.1|  408|Tribolium castaneum gustatory recept...    22   5.8  
AJ223627-1|CAA11500.1|  371|Tribolium castaneum orthodenticle-1 ...    22   5.8  
DQ855502-1|ABH88189.1|  126|Tribolium castaneum chemosensory pro...    21   7.7  
DQ855495-1|ABH88182.1|  126|Tribolium castaneum chemosensory pro...    21   7.7  
AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ...    21   7.7  
AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ...    21   7.7  
AY043292-1|AAK96031.1|  323|Tribolium castaneum homeodomain tran...    21   7.7  
AM292348-1|CAL23160.2|  346|Tribolium castaneum gustatory recept...    21   7.7  
AF228509-1|AAF69136.1|  325|Tribolium castaneum prothoraxless pr...    21   7.7  

>AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase
           variant 2 protein.
          Length = 1558

 Score = 27.1 bits (57), Expect = 0.15
 Identities = 13/45 (28%), Positives = 22/45 (48%)
 Frame = +2

Query: 416 IEFMDKTTELNLRSCQPKSFTYTFTTIWDTMTFSVSSSTIWCIRE 550
           I F+ K  ++     Q + F Y F ++W  + F VS   I  ++E
Sbjct: 278 IPFIKKLGKIKENLEQSRYFIYMFVSVWKCLLFFVSVLFILLVKE 322


>AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase
           variant 1 protein.
          Length = 1558

 Score = 27.1 bits (57), Expect = 0.15
 Identities = 13/45 (28%), Positives = 22/45 (48%)
 Frame = +2

Query: 416 IEFMDKTTELNLRSCQPKSFTYTFTTIWDTMTFSVSSSTIWCIRE 550
           I F+ K  ++     Q + F Y F ++W  + F VS   I  ++E
Sbjct: 278 IPFIKKLGKIKENLEQSRYFIYMFVSVWKCLLFFVSVLFILLVKE 322


>AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase
           CHS1B protein.
          Length = 1558

 Score = 27.1 bits (57), Expect = 0.15
 Identities = 13/45 (28%), Positives = 22/45 (48%)
 Frame = +2

Query: 416 IEFMDKTTELNLRSCQPKSFTYTFTTIWDTMTFSVSSSTIWCIRE 550
           I F+ K  ++     Q + F Y F ++W  + F VS   I  ++E
Sbjct: 278 IPFIKKLGKIKENLEQSRYFIYMFVSVWKCLLFFVSVLFILLVKE 322


>AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase
           CHS1A protein.
          Length = 1558

 Score = 27.1 bits (57), Expect = 0.15
 Identities = 13/45 (28%), Positives = 22/45 (48%)
 Frame = +2

Query: 416 IEFMDKTTELNLRSCQPKSFTYTFTTIWDTMTFSVSSSTIWCIRE 550
           I F+ K  ++     Q + F Y F ++W  + F VS   I  ++E
Sbjct: 278 IPFIKKLGKIKENLEQSRYFIYMFVSVWKCLLFFVSVLFILLVKE 322


>DQ855501-1|ABH88188.1|  146|Tribolium castaneum chemosensory
           protein 15 protein.
          Length = 146

 Score = 26.6 bits (56), Expect = 0.20
 Identities = 12/27 (44%), Positives = 13/27 (48%)
 Frame = +1

Query: 436 HRTQFAFVPAQEFYLHVYHHMGHHDFL 516
           H  Q  F P +E  L   H   HHDFL
Sbjct: 113 HLHQSKFNPHEEVKLQHLHQFPHHDFL 139


>DQ855491-1|ABH88178.1|  144|Tribolium castaneum chemosensory
           protein 5 protein.
          Length = 144

 Score = 23.4 bits (48), Expect = 1.9
 Identities = 8/15 (53%), Positives = 12/15 (80%)
 Frame = +1

Query: 583 LKTMKVLFYNVFFIL 627
           +KT  +LF+ VFFI+
Sbjct: 1   MKTFVILFFGVFFII 15


>AY362543-1|AAQ63455.1|  677|Tribolium castaneum chitin synthase
           protein.
          Length = 677

 Score = 22.2 bits (45), Expect = 4.4
 Identities = 11/36 (30%), Positives = 19/36 (52%)
 Frame = -2

Query: 368 RSTAAPRIFECLCISSNTQNGISKLLAKTTIW*GAP 261
           RS   P+I E    +  +Q+ I+++ A  T+W   P
Sbjct: 278 RSDEGPQITELEPETIESQDAITRIYAIATMWHETP 313


>AM292369-1|CAL23181.1|  408|Tribolium castaneum gustatory receptor
           candidate 48 protein.
          Length = 408

 Score = 21.8 bits (44), Expect = 5.8
 Identities = 9/16 (56%), Positives = 11/16 (68%)
 Frame = +2

Query: 605 FTTYFSYYSAPCAAII 652
           FT Y+ YYS   A+II
Sbjct: 154 FTVYYIYYSVHEASII 169


>AJ223627-1|CAA11500.1|  371|Tribolium castaneum orthodenticle-1
           protein protein.
          Length = 371

 Score = 21.8 bits (44), Expect = 5.8
 Identities = 12/37 (32%), Positives = 16/37 (43%)
 Frame = +1

Query: 394 HGLATVSHRIYGQNHRTQFAFVPAQEFYLHVYHHMGH 504
           HG  T SH  Y QN+   + +   Q  YL+      H
Sbjct: 291 HGHNTSSHNYYAQNYAPTY-YGQMQPDYLNSQTTQNH 326


>DQ855502-1|ABH88189.1|  126|Tribolium castaneum chemosensory
           protein 16 protein.
          Length = 126

 Score = 21.4 bits (43), Expect = 7.7
 Identities = 10/24 (41%), Positives = 13/24 (54%)
 Frame = +2

Query: 299 YLYHFACLMKYKDIQKYEVQQLIE 370
           +L   ACL  Y   Q+Y V Q I+
Sbjct: 6   FLLALACLKTYVSSQEYLVPQNID 29


>DQ855495-1|ABH88182.1|  126|Tribolium castaneum chemosensory
           protein 9 protein.
          Length = 126

 Score = 21.4 bits (43), Expect = 7.7
 Identities = 10/24 (41%), Positives = 13/24 (54%)
 Frame = +2

Query: 299 YLYHFACLMKYKDIQKYEVQQLIE 370
           +L   ACL  Y   Q+Y V Q I+
Sbjct: 6   FLLALACLKTYVSSQEYLVPQNID 29


>AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase
           protein.
          Length = 1464

 Score = 21.4 bits (43), Expect = 7.7
 Identities = 11/36 (30%), Positives = 19/36 (52%)
 Frame = -2

Query: 368 RSTAAPRIFECLCISSNTQNGISKLLAKTTIW*GAP 261
           RS   P+I E    +  +Q+ I+++ A  T+W   P
Sbjct: 511 RSDEGPQITELEPETIESQDAITRIYACGTMWHETP 546


>AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase
           CHS2 protein.
          Length = 1464

 Score = 21.4 bits (43), Expect = 7.7
 Identities = 11/36 (30%), Positives = 19/36 (52%)
 Frame = -2

Query: 368 RSTAAPRIFECLCISSNTQNGISKLLAKTTIW*GAP 261
           RS   P+I E    +  +Q+ I+++ A  T+W   P
Sbjct: 511 RSDEGPQITELEPETIESQDAITRIYACGTMWHETP 546


>AY043292-1|AAK96031.1|  323|Tribolium castaneum homeodomain
           transcription factor Prothoraxlessprotein.
          Length = 323

 Score = 21.4 bits (43), Expect = 7.7
 Identities = 6/6 (100%), Positives = 6/6 (100%)
 Frame = +1

Query: 490 HHMGHH 507
           HHMGHH
Sbjct: 165 HHMGHH 170


>AM292348-1|CAL23160.2|  346|Tribolium castaneum gustatory receptor
           candidate 27 protein.
          Length = 346

 Score = 21.4 bits (43), Expect = 7.7
 Identities = 13/35 (37%), Positives = 18/35 (51%)
 Frame = +1

Query: 598 VLFYNVFFILQCAMCRDHYMNVKGFLIYHIELIEI 702
           V+F  V+FIL  A     Y NV     ++  LI+I
Sbjct: 162 VVFDLVYFILAFACISIAYTNVSTDAFFYTCLIQI 196


>AF228509-1|AAF69136.1|  325|Tribolium castaneum prothoraxless
           protein.
          Length = 325

 Score = 21.4 bits (43), Expect = 7.7
 Identities = 6/6 (100%), Positives = 6/6 (100%)
 Frame = +1

Query: 490 HHMGHH 507
           HHMGHH
Sbjct: 167 HHMGHH 172


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 175,860
Number of Sequences: 336
Number of extensions: 3852
Number of successful extensions: 21
Number of sequences better than 10.0: 16
Number of HSP's better than 10.0 without gapping: 21
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 21
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 19363530
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -