SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120027.Seq
         (774 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292369-1|CAL23181.1|  408|Tribolium castaneum gustatory recept...    25   0.67 
AF263515-1|AAF74207.1|  126|Tribolium castaneum cytochrome P450 ...    22   4.7  
AY337337-1|AAP94192.1|  505|Tribolium castaneum cytochrome P450 ...    22   6.3  
AM292343-1|CAL23155.2|  301|Tribolium castaneum gustatory recept...    22   6.3  
AF254755-1|AAF70496.1|  505|Tribolium castaneum cytochrome P450 ...    22   6.3  
AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ...    21   8.3  
AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ...    21   8.3  

>AM292369-1|CAL23181.1|  408|Tribolium castaneum gustatory receptor
           candidate 48 protein.
          Length = 408

 Score = 25.0 bits (52), Expect = 0.67
 Identities = 11/31 (35%), Positives = 16/31 (51%)
 Frame = +2

Query: 191 FKYINVFVMRATFFCKLTLAANDREQPNDYD 283
           FKY+ V V  A F C   +  N R+   +Y+
Sbjct: 20  FKYLKVLVTFAHFICLFPITINIRKNGLNYN 50


>AF263515-1|AAF74207.1|  126|Tribolium castaneum cytochrome P450
           monooxygenase protein.
          Length = 126

 Score = 22.2 bits (45), Expect = 4.7
 Identities = 9/25 (36%), Positives = 12/25 (48%)
 Frame = +3

Query: 318 PTPSRASFDNGYSEFCDKQQPNDYL 392
           P P +   D    E CDK+ P  Y+
Sbjct: 102 PEPEKFDPDRFLPENCDKRHPYAYI 126


>AY337337-1|AAP94192.1|  505|Tribolium castaneum cytochrome P450
           monooxygenase protein.
          Length = 505

 Score = 21.8 bits (44), Expect = 6.3
 Identities = 10/31 (32%), Positives = 13/31 (41%)
 Frame = +3

Query: 318 PTPSRASFDNGYSEFCDKQQPNDYLNYYNNP 410
           P P +   D    E C K+ P  YL +   P
Sbjct: 418 PDPEKFDPDRFLPENCQKRHPFAYLPFSAGP 448


>AM292343-1|CAL23155.2|  301|Tribolium castaneum gustatory receptor
           candidate 22 protein.
          Length = 301

 Score = 21.8 bits (44), Expect = 6.3
 Identities = 8/15 (53%), Positives = 12/15 (80%)
 Frame = -1

Query: 465 LKLLQSRCQILPCRL 421
           LKL+Q++ +I  CRL
Sbjct: 248 LKLMQNKLEITACRL 262


>AF254755-1|AAF70496.1|  505|Tribolium castaneum cytochrome P450
           monooxigenase CYP4Q7 protein.
          Length = 505

 Score = 21.8 bits (44), Expect = 6.3
 Identities = 10/31 (32%), Positives = 13/31 (41%)
 Frame = +3

Query: 318 PTPSRASFDNGYSEFCDKQQPNDYLNYYNNP 410
           P P +   D    E C K+ P  YL +   P
Sbjct: 418 PDPEKFDPDRFLPENCQKRHPFAYLPFSAGP 448


>AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase
            protein.
          Length = 1464

 Score = 21.4 bits (43), Expect = 8.3
 Identities = 9/31 (29%), Positives = 18/31 (58%)
 Frame = -3

Query: 568  IISRTNCFSEIISGLEQTFHISLSSVNELTL 476
            +I R   FS+II+  +  F +    ++E+T+
Sbjct: 1303 MIHRFGTFSQIITKTQLDFDLCSKPIDEMTV 1333


>AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2
            protein.
          Length = 1464

 Score = 21.4 bits (43), Expect = 8.3
 Identities = 9/31 (29%), Positives = 18/31 (58%)
 Frame = -3

Query: 568  IISRTNCFSEIISGLEQTFHISLSSVNELTL 476
            +I R   FS+II+  +  F +    ++E+T+
Sbjct: 1303 MIHRFGTFSQIITKTQLDFDLCSKPIDEMTV 1333


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 179,852
Number of Sequences: 336
Number of extensions: 3798
Number of successful extensions: 11
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 10
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11
length of database: 122,585
effective HSP length: 56
effective length of database: 103,769
effective search space used: 20857569
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -