SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120026.Seq
         (729 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ659253-1|ABG47451.1|  439|Tribolium castaneum imaginal disc gr...    25   0.47 
AJ518940-1|CAD57734.1|  361|Tribolium castaneum extradenticle pr...    23   3.3  

>DQ659253-1|ABG47451.1|  439|Tribolium castaneum imaginal disc
           growth factor 2 protein.
          Length = 439

 Score = 25.4 bits (53), Expect = 0.47
 Identities = 14/50 (28%), Positives = 23/50 (46%), Gaps = 1/50 (2%)
 Frame = +3

Query: 321 QDERKMSKRKKKVINNNKYILF-NSWYTKIKQPEWPSSPAMWDLVKNTPE 467
           QDE K  K +  +    + + F NS YT +K   +      W+  +N P+
Sbjct: 114 QDEEKNIKYRNLLETTTRRLAFVNSAYTLVKAYGFDGLDLAWEFPENKPK 163


>AJ518940-1|CAD57734.1|  361|Tribolium castaneum extradenticle
           protein.
          Length = 361

 Score = 22.6 bits (46), Expect = 3.3
 Identities = 9/21 (42%), Positives = 14/21 (66%)
 Frame = +2

Query: 47  HHKRIARLLGIKKIYHQEYKR 109
           H    A+L  I++IYHQE ++
Sbjct: 144 HSDYRAKLAQIRQIYHQELEK 164


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 177,401
Number of Sequences: 336
Number of extensions: 4181
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 19467635
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -