SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120024.Seq
         (770 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292354-1|CAL23166.1|  321|Tribolium castaneum gustatory recept...    23   2.0  
AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr...    22   4.7  
AY043293-1|AAK96033.1|  523|Tribolium castaneum homeodomain tran...    22   6.2  
AF187069-1|AAF03889.1|  471|Tribolium castaneum proboscipedia or...    22   6.2  
AF187068-1|AAF03888.1|  477|Tribolium castaneum proboscipedia or...    22   6.2  

>AM292354-1|CAL23166.1|  321|Tribolium castaneum gustatory receptor
           candidate 33 protein.
          Length = 321

 Score = 23.4 bits (48), Expect = 2.0
 Identities = 11/49 (22%), Positives = 27/49 (55%), Gaps = 2/49 (4%)
 Frame = -1

Query: 164 IQMMHENTLFDNHQKFYWTILIASCPCLISDELRKN--YIHNYLVTTIY 24
           I  +++   ++  +K YW+  +A+   L   ++RKN  Y+  +++  +Y
Sbjct: 63  ISNVYQILAYNFWKKKYWSEFLANLKLLKGRKIRKNLYYLLLFVINVLY 111


>AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like
           protein protein.
          Length = 1156

 Score = 22.2 bits (45), Expect = 4.7
 Identities = 7/21 (33%), Positives = 11/21 (52%)
 Frame = -1

Query: 668 STKSLHSPWTSTWITNSSKSA 606
           S  + HS W S W+   ++ A
Sbjct: 354 SASNRHSAWQSHWLNKGAEQA 374


>AY043293-1|AAK96033.1|  523|Tribolium castaneum homeodomain
           transcription factor Maxillopediaprotein.
          Length = 523

 Score = 21.8 bits (44), Expect = 6.2
 Identities = 9/23 (39%), Positives = 14/23 (60%)
 Frame = -1

Query: 371 SPSILTPRGEVSGPTTITPCSAA 303
           +PS++ P    S PTT T  ++A
Sbjct: 240 APSVMYPHLNRSSPTTATAIASA 262


>AF187069-1|AAF03889.1|  471|Tribolium castaneum proboscipedia
           ortholog protein.
          Length = 471

 Score = 21.8 bits (44), Expect = 6.2
 Identities = 9/23 (39%), Positives = 14/23 (60%)
 Frame = -1

Query: 371 SPSILTPRGEVSGPTTITPCSAA 303
           +PS++ P    S PTT T  ++A
Sbjct: 188 APSVMYPHLNRSSPTTATAIASA 210


>AF187068-1|AAF03888.1|  477|Tribolium castaneum proboscipedia
           ortholog protein.
          Length = 477

 Score = 21.8 bits (44), Expect = 6.2
 Identities = 9/23 (39%), Positives = 14/23 (60%)
 Frame = -1

Query: 371 SPSILTPRGEVSGPTTITPCSAA 303
           +PS++ P    S PTT T  ++A
Sbjct: 371 APSVMYPHLNRSSPTTATAIASA 393


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 199,726
Number of Sequences: 336
Number of extensions: 4832
Number of successful extensions: 10
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 10
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10
length of database: 122,585
effective HSP length: 56
effective length of database: 103,769
effective search space used: 20753800
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -