SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120021.Seq
         (683 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY321476-2|AAQ23387.1|  257|Tribolium castaneum Ase protein.           24   1.0  
AF442747-1|AAL40947.1|  669|Tribolium castaneum ABC transmembran...    23   2.3  
AF422804-1|AAL56571.1|  669|Tribolium castaneum ABC transmembran...    23   2.3  
AY293621-1|AAP46162.1|  392|Tribolium castaneum glass protein pr...    22   4.1  
AF263515-1|AAF74207.1|  126|Tribolium castaneum cytochrome P450 ...    22   4.1  
AJ845189-1|CAH60166.1|  515|Tribolium castaneum putative esteras...    21   7.1  
DQ490059-1|ABF22614.1|  947|Tribolium castaneum short gastrulati...    21   9.4  

>AY321476-2|AAQ23387.1|  257|Tribolium castaneum Ase protein.
          Length = 257

 Score = 24.2 bits (50), Expect = 1.0
 Identities = 16/53 (30%), Positives = 27/53 (50%)
 Frame = +1

Query: 364 RVVFLRLEAPNVLAIRTLQLSFSKFTKASVSNSRLSILTIDGLSTEHNTPPRF 522
           +V  LR+    + ++  L L+  + T +S ++S  S  T D LST    PP +
Sbjct: 100 KVETLRMAVEYIRSLEDL-LALDESTVSSSTSSIPSPSTTDDLSTNPTPPPHY 151


>AF442747-1|AAL40947.1|  669|Tribolium castaneum ABC transmembrane
           transporter protein.
          Length = 669

 Score = 23.0 bits (47), Expect = 2.3
 Identities = 13/39 (33%), Positives = 24/39 (61%)
 Frame = +1

Query: 145 AHCRSQFVGKKRMVR*RLAIFKHPVIFKNIIMQIGMLTI 261
           A C +QF  K  + R  LA+FK P++ K  ++Q  ++++
Sbjct: 391 ASCWAQF--KAVLWRSILAVFKEPLLIKVRLLQTLIISL 427


>AF422804-1|AAL56571.1|  669|Tribolium castaneum ABC transmembrane
           transporter white protein.
          Length = 669

 Score = 23.0 bits (47), Expect = 2.3
 Identities = 13/39 (33%), Positives = 24/39 (61%)
 Frame = +1

Query: 145 AHCRSQFVGKKRMVR*RLAIFKHPVIFKNIIMQIGMLTI 261
           A C +QF  K  + R  LA+FK P++ K  ++Q  ++++
Sbjct: 391 ASCWAQF--KAVLWRSILAVFKEPLLIKVRLLQTLIISL 427


>AY293621-1|AAP46162.1|  392|Tribolium castaneum glass protein
           protein.
          Length = 392

 Score = 22.2 bits (45), Expect = 4.1
 Identities = 8/25 (32%), Positives = 12/25 (48%)
 Frame = +2

Query: 509 HPLVFCKQNGFSGNACVISFSDHKL 583
           HP V     G+SG+ C   F+   +
Sbjct: 119 HPQVLLSPGGYSGSLCDQGFAQQPM 143


>AF263515-1|AAF74207.1|  126|Tribolium castaneum cytochrome P450
           monooxygenase protein.
          Length = 126

 Score = 22.2 bits (45), Expect = 4.1
 Identities = 7/10 (70%), Positives = 9/10 (90%)
 Frame = -1

Query: 179 RFLPTNCDRQ 150
           RFLP NCD++
Sbjct: 111 RFLPENCDKR 120


>AJ845189-1|CAH60166.1|  515|Tribolium castaneum putative esterase
           protein.
          Length = 515

 Score = 21.4 bits (43), Expect = 7.1
 Identities = 9/31 (29%), Positives = 14/31 (45%)
 Frame = -2

Query: 613 PLVTNFTNKMEFVVTETNDTSIPGEPILFTE 521
           P++  +T +   +V     T  PG P  F E
Sbjct: 300 PMIFGYTTREGMIVEMMRKTETPGMPNDFEE 330


>DQ490059-1|ABF22614.1|  947|Tribolium castaneum short gastrulation
           protein.
          Length = 947

 Score = 21.0 bits (42), Expect = 9.4
 Identities = 6/19 (31%), Positives = 11/19 (57%)
 Frame = +2

Query: 323 YRNLVVYLTRNHRCASCFC 379
           YR    + + ++ C +CFC
Sbjct: 680 YRQEAQWTSSDNPCTTCFC 698


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 139,092
Number of Sequences: 336
Number of extensions: 2786
Number of successful extensions: 7
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 17906060
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -