SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120019.Seq
         (804 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF222293-1|ABN79653.1|  434|Tribolium castaneum ecdysis triggeri...    25   0.71 
AJ850297-1|CAH64517.1|  539|Tribolium castaneum putative esteras...    23   2.2  
AJ850295-1|CAH64515.1|  539|Tribolium castaneum putative esteras...    23   2.2  
AJ850294-1|CAH64514.1|  539|Tribolium castaneum putative esteras...    23   2.2  
AJ850293-1|CAH64513.1|  539|Tribolium castaneum putative esteras...    23   2.2  
AJ850292-1|CAH64512.1|  539|Tribolium castaneum putative esteras...    23   2.2  
EF633444-1|ABR32189.1|  721|Tribolium castaneum heat shock prote...    23   3.8  
AM292336-1|CAL23148.2|  455|Tribolium castaneum gustatory recept...    22   6.6  
AJ005083-1|CAB65469.1|  585|Tribolium castaneum signal receptor ...    22   6.6  

>EF222293-1|ABN79653.1|  434|Tribolium castaneum ecdysis triggering
           hormone receptorisoform A protein.
          Length = 434

 Score = 25.0 bits (52), Expect = 0.71
 Identities = 12/37 (32%), Positives = 21/37 (56%)
 Frame = -3

Query: 598 TYSFVSATRVKKSRFRNVRNHVTQCGRPKITNVSIRD 488
           T+S  +A   + S FRN R+    C RP+  ++ I++
Sbjct: 381 TFS-TTANSCRSSTFRNNRDEYNVCFRPRNNSILIKN 416


>AJ850297-1|CAH64517.1|  539|Tribolium castaneum putative esterase
           protein.
          Length = 539

 Score = 23.4 bits (48), Expect = 2.2
 Identities = 10/22 (45%), Positives = 16/22 (72%)
 Frame = -3

Query: 67  MSTFGSFWFSDTFIWPSLVFVS 2
           M+ +GSF+  D FI  ++VFV+
Sbjct: 124 MTGYGSFYQPDYFIDKNIVFVN 145


>AJ850295-1|CAH64515.1|  539|Tribolium castaneum putative esterase
           protein.
          Length = 539

 Score = 23.4 bits (48), Expect = 2.2
 Identities = 10/22 (45%), Positives = 16/22 (72%)
 Frame = -3

Query: 67  MSTFGSFWFSDTFIWPSLVFVS 2
           M+ +GSF+  D FI  ++VFV+
Sbjct: 124 MTGYGSFYQPDYFIDKNIVFVN 145


>AJ850294-1|CAH64514.1|  539|Tribolium castaneum putative esterase
           protein.
          Length = 539

 Score = 23.4 bits (48), Expect = 2.2
 Identities = 10/22 (45%), Positives = 16/22 (72%)
 Frame = -3

Query: 67  MSTFGSFWFSDTFIWPSLVFVS 2
           M+ +GSF+  D FI  ++VFV+
Sbjct: 124 MTGYGSFYQPDYFIDKNIVFVN 145


>AJ850293-1|CAH64513.1|  539|Tribolium castaneum putative esterase
           protein.
          Length = 539

 Score = 23.4 bits (48), Expect = 2.2
 Identities = 10/22 (45%), Positives = 16/22 (72%)
 Frame = -3

Query: 67  MSTFGSFWFSDTFIWPSLVFVS 2
           M+ +GSF+  D FI  ++VFV+
Sbjct: 124 MTGYGSFYQPDYFIDKNIVFVN 145


>AJ850292-1|CAH64512.1|  539|Tribolium castaneum putative esterase
           protein.
          Length = 539

 Score = 23.4 bits (48), Expect = 2.2
 Identities = 10/22 (45%), Positives = 16/22 (72%)
 Frame = -3

Query: 67  MSTFGSFWFSDTFIWPSLVFVS 2
           M+ +GSF+  D FI  ++VFV+
Sbjct: 124 MTGYGSFYQPDYFIDKNIVFVN 145


>EF633444-1|ABR32189.1|  721|Tribolium castaneum heat shock protein
           90 protein.
          Length = 721

 Score = 22.6 bits (46), Expect = 3.8
 Identities = 7/31 (22%), Positives = 18/31 (58%)
 Frame = +1

Query: 124 INTRDNFRDNIAEHVFDMLLERHGSFENYPI 216
           ++ +++  + + EH    ++++H  F  YPI
Sbjct: 181 LHMKEDQTEFLEEHKIKEIVKKHSQFIGYPI 211


>AM292336-1|CAL23148.2|  455|Tribolium castaneum gustatory receptor
           candidate 15 protein.
          Length = 455

 Score = 21.8 bits (44), Expect = 6.6
 Identities = 13/41 (31%), Positives = 17/41 (41%)
 Frame = -3

Query: 748 FINVSGSNCVLTKLFTFHRQYKITLRVFGGVSLPGVFVNMP 626
           FIN S    V   LF   +  +    +FG   L  VF  +P
Sbjct: 184 FINESNVETVKFNLFLLSQAVETFNDIFGWTILQTVFFTVP 224


>AJ005083-1|CAB65469.1|  585|Tribolium castaneum signal receptor
           protein protein.
          Length = 585

 Score = 21.8 bits (44), Expect = 6.6
 Identities = 8/27 (29%), Positives = 10/27 (37%)
 Frame = +2

Query: 605 CDCCVRDWHINEDAWQRHATENPQCYF 685
           C    R W +  D        NP+C F
Sbjct: 528 CTASTRCWEVFMDGICNEDCNNPECLF 554


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 183,146
Number of Sequences: 336
Number of extensions: 4261
Number of successful extensions: 12
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 12
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12
length of database: 122,585
effective HSP length: 56
effective length of database: 103,769
effective search space used: 21895259
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -