SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120018.Seq
         (789 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292341-1|CAL23153.2|  393|Tribolium castaneum gustatory recept...    26   0.30 
X97819-1|CAA66399.1|  251|Tribolium castaneum ZEN Tc protein.          24   1.2  
AF321227-4|AAK16424.1|  246|Tribolium castaneum Zen protein.           24   1.2  
AM295014-1|CAL25729.1|  407|Tribolium castaneum ultraspiracle nu...    23   2.8  
AM292354-1|CAL23166.1|  321|Tribolium castaneum gustatory recept...    23   2.8  
AJ606487-1|CAE55183.1|  203|Tribolium castaneum Giant protein pr...    23   3.7  
AF227923-1|AAF36721.1|  351|Tribolium castaneum abdominal-B prot...    22   4.9  
EF117815-1|ABO38438.1|  535|Tribolium castaneum cryptochrome 2 p...    22   6.4  

>AM292341-1|CAL23153.2|  393|Tribolium castaneum gustatory receptor
           candidate 20 protein.
          Length = 393

 Score = 26.2 bits (55), Expect = 0.30
 Identities = 17/39 (43%), Positives = 22/39 (56%), Gaps = 2/39 (5%)
 Frame = -1

Query: 444 FLPCMAKYGWQQICLNFSISHNTCCICCNRLS--VFSLS 334
           FLP  +    Q+ CLN SI++   CIC    S  +FSLS
Sbjct: 27  FLPVCSSQKGQKTCLNLSINY---CICGYIFSAILFSLS 62


>X97819-1|CAA66399.1|  251|Tribolium castaneum ZEN Tc protein.
          Length = 251

 Score = 24.2 bits (50), Expect = 1.2
 Identities = 14/48 (29%), Positives = 24/48 (50%), Gaps = 1/48 (2%)
 Frame = +3

Query: 237 EYVHVNLMKKKKRCTIS*NVNRKRRI*KLW-QRVKAKTR*ADCSKCST 377
           E+ H   + + +R  I+ N+N   R  K+W Q  + K +    +K ST
Sbjct: 106 EFHHGKYLSRPRRIQIAENLNLSERQIKIWFQNRRMKHKKEQMNKVST 153


>AF321227-4|AAK16424.1|  246|Tribolium castaneum Zen protein.
          Length = 246

 Score = 24.2 bits (50), Expect = 1.2
 Identities = 14/48 (29%), Positives = 24/48 (50%), Gaps = 1/48 (2%)
 Frame = +3

Query: 237 EYVHVNLMKKKKRCTIS*NVNRKRRI*KLW-QRVKAKTR*ADCSKCST 377
           E+ H   + + +R  I+ N+N   R  K+W Q  + K +    +K ST
Sbjct: 97  EFHHGKYLSRPRRIQIAENLNLSERQIKIWFQNRRMKHKKEQMNKVST 144


>AM295014-1|CAL25729.1|  407|Tribolium castaneum ultraspiracle
           nuclear receptor protein.
          Length = 407

 Score = 23.0 bits (47), Expect = 2.8
 Identities = 9/19 (47%), Positives = 13/19 (68%)
 Frame = +3

Query: 105 NDPRVWKMLNKNNDSTNRI 161
           NDP V  ++N+NN + N I
Sbjct: 196 NDPLVALVVNENNTTVNNI 214


>AM292354-1|CAL23166.1|  321|Tribolium castaneum gustatory receptor
           candidate 33 protein.
          Length = 321

 Score = 23.0 bits (47), Expect = 2.8
 Identities = 9/24 (37%), Positives = 14/24 (58%)
 Frame = -2

Query: 119 HSWIVKRTTLQKINHRVHIPVFVV 48
           H   V++TTL   N    +P+F+V
Sbjct: 178 HGMTVQKTTLFFFNRTFGVPIFLV 201


>AJ606487-1|CAE55183.1|  203|Tribolium castaneum Giant protein
           protein.
          Length = 203

 Score = 22.6 bits (46), Expect = 3.7
 Identities = 7/18 (38%), Positives = 11/18 (61%)
 Frame = +3

Query: 105 NDPRVWKMLNKNNDSTNR 158
           +DP  W+   KNN++  R
Sbjct: 134 DDPSYWEKRRKNNEAAKR 151


>AF227923-1|AAF36721.1|  351|Tribolium castaneum abdominal-B
           protein.
          Length = 351

 Score = 22.2 bits (45), Expect = 4.9
 Identities = 13/48 (27%), Positives = 23/48 (47%)
 Frame = +3

Query: 183 VLKRDKSEISFNIPKHTVEYVHVNLMKKKKRCTIS*NVNRKRRI*KLW 326
           V K+ K    F   +   E++    + K+KR  ++ N+N   R  K+W
Sbjct: 243 VRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLNLTERQVKIW 290


>EF117815-1|ABO38438.1|  535|Tribolium castaneum cryptochrome 2
           protein.
          Length = 535

 Score = 21.8 bits (44), Expect = 6.4
 Identities = 8/25 (32%), Positives = 16/25 (64%)
 Frame = -2

Query: 98  TTLQKINHRVHIPVFVVDRCAGDAP 24
           + +QK++H ++    ++DR  G AP
Sbjct: 137 SVVQKVSHTLYHLQDIIDRNGGRAP 161


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 188,709
Number of Sequences: 336
Number of extensions: 4243
Number of successful extensions: 12
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 12
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12
length of database: 122,585
effective HSP length: 56
effective length of database: 103,769
effective search space used: 21376414
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -