SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120017.Seq
         (731 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

S73225-1|AAB30811.1|  327|Tribolium castaneum protein ( Triboliu...    27   0.12 
AJ005083-1|CAB65469.1|  585|Tribolium castaneum signal receptor ...    25   0.83 
AY043293-2|AAK96034.1|  353|Tribolium castaneum homeodomain tran...    23   1.9  
AF231104-1|AAF64149.1|  142|Tribolium castaneum labial protein p...    23   1.9  
AF231103-1|AAF64148.1|  142|Tribolium castaneum labial protein p...    23   1.9  
X97819-1|CAA66399.1|  251|Tribolium castaneum ZEN Tc protein.          22   4.4  
EF125544-1|ABL73928.1|  279|Tribolium castaneum obstractor B pro...    22   4.4  
AF321227-4|AAK16424.1|  246|Tribolium castaneum Zen protein.           22   4.4  
DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro...    21   7.8  

>S73225-1|AAB30811.1|  327|Tribolium castaneum protein ( Tribolium
           castaneum homeodomainprotein mRNA, complete cds. ).
          Length = 327

 Score = 27.5 bits (58), Expect = 0.12
 Identities = 17/58 (29%), Positives = 29/58 (50%)
 Frame = +1

Query: 34  NTPPPPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNSVAIAPYNK 207
           +T  P  + PS+P   I + + T + +PG++  T  D  +D  R +ST       YN+
Sbjct: 58  STLDPGRKSPSSPR--ISSPSSTKSGSPGFLTYTKADRDVDLFRGSSTPESPEHYYNQ 113


>AJ005083-1|CAB65469.1|  585|Tribolium castaneum signal receptor
           protein protein.
          Length = 585

 Score = 24.6 bits (51), Expect = 0.83
 Identities = 16/47 (34%), Positives = 21/47 (44%)
 Frame = -3

Query: 576 LPNISAPPL*NFCAYAGSEFSTKMPEIYSNRSAGTRPRCLVPTLFAT 436
           L  I    L ++  Y   + + K  EIY     G   R +VPTL AT
Sbjct: 428 LDAICQDKLGDYACYCPPKHTGKNCEIYDRGFPGGLGRAVVPTLDAT 474


>AY043293-2|AAK96034.1|  353|Tribolium castaneum homeodomain
           transcription factor Labialprotein.
          Length = 353

 Score = 23.4 bits (48), Expect = 1.9
 Identities = 11/33 (33%), Positives = 15/33 (45%)
 Frame = +1

Query: 118 GYVPPTTRDNKMDTSRSNSTNSVAIAPYNKSKE 216
           G +PP      + TS SNS +S  +     S E
Sbjct: 315 GLIPPEPISASLSTSNSNSPSSTNLIQNEASNE 347


>AF231104-1|AAF64149.1|  142|Tribolium castaneum labial protein
           protein.
          Length = 142

 Score = 23.4 bits (48), Expect = 1.9
 Identities = 11/33 (33%), Positives = 15/33 (45%)
 Frame = +1

Query: 118 GYVPPTTRDNKMDTSRSNSTNSVAIAPYNKSKE 216
           G +PP      + TS SNS +S  +     S E
Sbjct: 104 GLIPPEPISASLSTSNSNSPSSTNLIQNEASNE 136


>AF231103-1|AAF64148.1|  142|Tribolium castaneum labial protein
           protein.
          Length = 142

 Score = 23.4 bits (48), Expect = 1.9
 Identities = 11/33 (33%), Positives = 15/33 (45%)
 Frame = +1

Query: 118 GYVPPTTRDNKMDTSRSNSTNSVAIAPYNKSKE 216
           G +PP      + TS SNS +S  +     S E
Sbjct: 104 GLIPPEPISASLSTSNSNSPSSTNLIQNEASNE 136


>X97819-1|CAA66399.1|  251|Tribolium castaneum ZEN Tc protein.
          Length = 251

 Score = 22.2 bits (45), Expect = 4.4
 Identities = 14/52 (26%), Positives = 21/52 (40%), Gaps = 2/52 (3%)
 Frame = +1

Query: 28  YY--NTPPPPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRSNST 177
           YY  N   PP+ YP +       NA  Y ++   +P  T   +    R+  T
Sbjct: 35  YYENNQALPPITYPPSDWNCPQYNAPPYMSSVLQLPTVTEIQETQPQRTKPT 86


>EF125544-1|ABL73928.1|  279|Tribolium castaneum obstractor B
           protein.
          Length = 279

 Score = 22.2 bits (45), Expect = 4.4
 Identities = 11/32 (34%), Positives = 16/32 (50%)
 Frame = -1

Query: 665 TEWECCTSPIPPPCTGRPS*VVCPPRPKRLYP 570
           +E+E C  P    CT RP   +  P+P +  P
Sbjct: 79  SEYEKCDLPFNIDCTSRPK--LQEPQPSQHCP 108


>AF321227-4|AAK16424.1|  246|Tribolium castaneum Zen protein.
          Length = 246

 Score = 22.2 bits (45), Expect = 4.4
 Identities = 14/52 (26%), Positives = 21/52 (40%), Gaps = 2/52 (3%)
 Frame = +1

Query: 28  YY--NTPPPPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRSNST 177
           YY  N   PP+ YP +       NA  Y ++   +P  T   +    R+  T
Sbjct: 26  YYENNQALPPITYPPSDWNCPQYNAPPYMSSVLQLPTVTEIQETQPQRTKPT 77


>DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein.
          Length = 2700

 Score = 21.4 bits (43), Expect = 7.8
 Identities = 11/29 (37%), Positives = 13/29 (44%)
 Frame = -1

Query: 671  TVTEWECCTSPIPPPCTGRPS*VVCPPRP 585
            T T W    + IPPP    P  V  P +P
Sbjct: 1075 TTTNWPTQGTTIPPPAVVMPE-VDKPSQP 1102


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 170,988
Number of Sequences: 336
Number of extensions: 3960
Number of successful extensions: 14
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 14
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 14
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 19571740
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -