SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120016.Seq
         (678 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U09586-2|AAC47271.1|  712|Tribolium castaneum protease, reverse ...    58   5e-11
AM292348-1|CAL23160.2|  346|Tribolium castaneum gustatory recept...    22   5.3  

>U09586-2|AAC47271.1|  712|Tribolium castaneum protease, reverse
           transcriptase andRNase H protein.
          Length = 712

 Score = 58.4 bits (135), Expect = 5e-11
 Identities = 25/70 (35%), Positives = 45/70 (64%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           F+ ++   + IN  K  F   EV FLG+ ++ +G +   E+I A+++FP+PQ  + +R F
Sbjct: 479 FEKLKQARMTINLEKSNFIQKEVKFLGHILTINGIKADPEKISAIRNFPVPQKTKHVRAF 538

Query: 424 IGMVNYYRRF 453
           +G+ N+YR+F
Sbjct: 539 LGLCNFYRKF 548



 Score = 39.1 bits (87), Expect = 3e-05
 Identities = 20/51 (39%), Positives = 29/51 (56%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           TIDL  +Y QIP++PE    TA +     Y +  + FGL+ A  +F R +D
Sbjct: 393 TIDLRSSYWQIPLSPESRQYTAFLYNGRSYTYQVLPFGLKTAVGSFSRAMD 443



 Score = 34.7 bits (76), Expect = 7e-04
 Identities = 14/32 (43%), Positives = 21/32 (65%)
 Frame = +2

Query: 164 DFCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           +F   Y+DD+LV S    +H  HLR +F++LK
Sbjct: 452 EFVVNYIDDLLVASETLNEHLEHLRQVFEKLK 483


>AM292348-1|CAL23160.2|  346|Tribolium castaneum gustatory receptor
           candidate 27 protein.
          Length = 346

 Score = 21.8 bits (44), Expect = 5.3
 Identities = 13/45 (28%), Positives = 23/45 (51%)
 Frame = -1

Query: 447 AIIINHPNETTESLYSLW*RKIF*SLNAL*WWLCSVGGYSVSEKS 313
           A+ + H    T  LY ++    F ++     W+C++  Y+VSE S
Sbjct: 19  ALTVWHVENPTYRLYKIFVVFSF-AVTFFSAWICALVNYNVSEIS 62


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 147,158
Number of Sequences: 336
Number of extensions: 3256
Number of successful extensions: 6
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 17697850
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -