SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120012.Seq
         (701 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF592539-1|ABQ95985.1|  630|Tribolium castaneum beta-N-acetylglu...    25   0.60 
DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad...    21   9.7  
AM292363-1|CAL23175.2|  347|Tribolium castaneum gustatory recept...    21   9.7  
AM292362-1|CAL23174.2|  398|Tribolium castaneum gustatory recept...    21   9.7  

>EF592539-1|ABQ95985.1|  630|Tribolium castaneum
           beta-N-acetylglucosaminidase FDL protein.
          Length = 630

 Score = 25.0 bits (52), Expect = 0.60
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = -3

Query: 462 FFSSCCLIAGSYLPVHST*GITSSK 388
           FFS CC++   YL    T  +T+SK
Sbjct: 12  FFSFCCILFFIYLYWQQTSNLTTSK 36


>DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome
           adhesion molecule splicevariant 3.12.3.1 protein.
          Length = 1639

 Score = 21.0 bits (42), Expect = 9.7
 Identities = 7/14 (50%), Positives = 10/14 (71%)
 Frame = +3

Query: 402 FLKCYARASTTPQL 443
           FLKC A  + TP++
Sbjct: 432 FLKCIASGNPTPEI 445


>AM292363-1|CAL23175.2|  347|Tribolium castaneum gustatory receptor
           candidate 42 protein.
          Length = 347

 Score = 21.0 bits (42), Expect = 9.7
 Identities = 13/38 (34%), Positives = 18/38 (47%)
 Frame = -2

Query: 271 CHAVWSEGGSLAPDSLYVYLYFLSTCLLTASLQFPYFK 158
           CH     G  LAP+  Y+ +   S  + T  L F YF+
Sbjct: 109 CHTF---GRFLAPNLTYLLVALYSGYVWTDILGFGYFR 143


>AM292362-1|CAL23174.2|  398|Tribolium castaneum gustatory receptor
           candidate 41 protein.
          Length = 398

 Score = 21.0 bits (42), Expect = 9.7
 Identities = 8/20 (40%), Positives = 13/20 (65%)
 Frame = -1

Query: 698 HHFIFSLHSFLKPGVHAVEV 639
           H +IF + +F+   V A+EV
Sbjct: 158 HTYIFDVPNFVNEYVQAIEV 177


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 159,624
Number of Sequences: 336
Number of extensions: 3619
Number of successful extensions: 5
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 18530690
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -