SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120008.Seq
         (681 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY887136-1|AAW78361.1|  580|Tribolium castaneum vasa RNA helicas...    75   4e-16
AM292382-1|CAL23194.2|  670|Tribolium castaneum gustatory recept...    28   0.062
AM292340-1|CAL23152.1|  355|Tribolium castaneum gustatory recept...    23   2.3  

>AY887136-1|AAW78361.1|  580|Tribolium castaneum vasa RNA helicase
           protein.
          Length = 580

 Score = 75.4 bits (177), Expect = 4e-16
 Identities = 40/82 (48%), Positives = 56/82 (68%), Gaps = 4/82 (4%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKII-EQIRP---DRQTLMWSAT 424
           GRL DF+ +G  +     Y VLDEADRMLDMGF   + +++  Q  P   +RQTLM+SAT
Sbjct: 294 GRLKDFVNRGNVSFNSLKYFVLDEADRMLDMGFLGDVEEMLSHQSMPATGERQTLMFSAT 353

Query: 425 WPKEVKKLAEDYLGDYIQINIG 490
           +P+EV++LA  +L +YI I +G
Sbjct: 354 FPEEVQQLAGKFLLNYIFIAVG 375



 Score = 54.8 bits (126), Expect = 6e-10
 Identities = 30/88 (34%), Positives = 48/88 (54%), Gaps = 4/88 (4%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHI--NNQPPIRRGD--GPIALVLAPTRELAQQIQQVAADFGHTSYV 170
           GSGKT A++LP I ++  +  PP    +   P+ ++++PTRELA QI      F + S V
Sbjct: 205 GSGKTAAFMLPIIHNLLSDKNPPNTENNCAQPVVVIMSPTRELAIQIADQGKKFAYNSTV 264

Query: 171 RNTCVFGGAPKREQARDLERGVEIVIAT 254
           +   ++GG     Q   +  G  I++AT
Sbjct: 265 KVAVIYGGTSTNHQRGRILGGCHILVAT 292



 Score = 24.2 bits (50), Expect = 1.0
 Identities = 13/31 (41%), Positives = 20/31 (64%)
 Frame = +1

Query: 550 EKENKLNVLLQEIGQSQEPGAKTIIFVETKR 642
           +K +KL  +L++      P  +T+IFVETKR
Sbjct: 395 DKRSKLVSILEKA-----PNERTLIFVETKR 420


>AM292382-1|CAL23194.2|  670|Tribolium castaneum gustatory receptor
           candidate 61 protein.
          Length = 670

 Score = 28.3 bits (60), Expect = 0.062
 Identities = 16/54 (29%), Positives = 29/54 (53%), Gaps = 1/54 (1%)
 Frame = +1

Query: 397 QTDFDVVSYLAQRSEETC*GLLGRLHSDQYRIITTFRNHNILQIVDIC-QEHEK 555
           +T F V + + +R       +L +L+ ++YR +      +  QIVDIC + H+K
Sbjct: 469 ETQFVVANIILRRRFALINSILRKLYKNKYRKLIVDGKKSEEQIVDICIRSHDK 522


>AM292340-1|CAL23152.1|  355|Tribolium castaneum gustatory receptor
           candidate 19 protein.
          Length = 355

 Score = 23.0 bits (47), Expect = 2.3
 Identities = 19/56 (33%), Positives = 24/56 (42%), Gaps = 3/56 (5%)
 Frame = -3

Query: 673 LLMFLDMFSAFSWFQQKLLFLHQVLDFVQ---FLAIIHLIYFLFHVLDKYLQFEEC 515
           LL     + AF  F   LLFL  +  FV    FL  I+  Y  F +   +L F  C
Sbjct: 110 LLCVYYFYYAFIIFTVHLLFLLCIYYFVVPLFFLLCIYYFYCAFIIFTVHLLFLLC 165



 Score = 21.4 bits (43), Expect = 7.1
 Identities = 13/39 (33%), Positives = 18/39 (46%)
 Frame = -3

Query: 667 MFLDMFSAFSWFQQKLLFLHQVLDFVQFLAIIHLIYFLF 551
           M L    AF +F   LLFL  +  F   L  +  IY+ +
Sbjct: 178 MHLLFCCAFIFFNMHLLFLLCLDYFTLHLLFLPCIYYFY 216


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 169,660
Number of Sequences: 336
Number of extensions: 3874
Number of successful extensions: 12
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 17801955
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -