SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120003.Seq
         (731 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ850297-1|CAH64517.1|  539|Tribolium castaneum putative esteras...    23   1.9  
AJ850295-1|CAH64515.1|  539|Tribolium castaneum putative esteras...    23   1.9  
AJ850294-1|CAH64514.1|  539|Tribolium castaneum putative esteras...    23   1.9  
AJ850293-1|CAH64513.1|  539|Tribolium castaneum putative esteras...    23   1.9  
AJ850292-1|CAH64512.1|  539|Tribolium castaneum putative esteras...    23   1.9  
EF633444-1|ABR32189.1|  721|Tribolium castaneum heat shock prote...    23   3.4  
AJ415419-1|CAC94468.1|  441|Tribolium castaneum transcription fa...    21   7.8  

>AJ850297-1|CAH64517.1|  539|Tribolium castaneum putative esterase
           protein.
          Length = 539

 Score = 23.4 bits (48), Expect = 1.9
 Identities = 10/22 (45%), Positives = 16/22 (72%)
 Frame = -1

Query: 356 MSTFGSFWFSDTFIWPSLVFVS 291
           M+ +GSF+  D FI  ++VFV+
Sbjct: 124 MTGYGSFYQPDYFIDKNIVFVN 145


>AJ850295-1|CAH64515.1|  539|Tribolium castaneum putative esterase
           protein.
          Length = 539

 Score = 23.4 bits (48), Expect = 1.9
 Identities = 10/22 (45%), Positives = 16/22 (72%)
 Frame = -1

Query: 356 MSTFGSFWFSDTFIWPSLVFVS 291
           M+ +GSF+  D FI  ++VFV+
Sbjct: 124 MTGYGSFYQPDYFIDKNIVFVN 145


>AJ850294-1|CAH64514.1|  539|Tribolium castaneum putative esterase
           protein.
          Length = 539

 Score = 23.4 bits (48), Expect = 1.9
 Identities = 10/22 (45%), Positives = 16/22 (72%)
 Frame = -1

Query: 356 MSTFGSFWFSDTFIWPSLVFVS 291
           M+ +GSF+  D FI  ++VFV+
Sbjct: 124 MTGYGSFYQPDYFIDKNIVFVN 145


>AJ850293-1|CAH64513.1|  539|Tribolium castaneum putative esterase
           protein.
          Length = 539

 Score = 23.4 bits (48), Expect = 1.9
 Identities = 10/22 (45%), Positives = 16/22 (72%)
 Frame = -1

Query: 356 MSTFGSFWFSDTFIWPSLVFVS 291
           M+ +GSF+  D FI  ++VFV+
Sbjct: 124 MTGYGSFYQPDYFIDKNIVFVN 145


>AJ850292-1|CAH64512.1|  539|Tribolium castaneum putative esterase
           protein.
          Length = 539

 Score = 23.4 bits (48), Expect = 1.9
 Identities = 10/22 (45%), Positives = 16/22 (72%)
 Frame = -1

Query: 356 MSTFGSFWFSDTFIWPSLVFVS 291
           M+ +GSF+  D FI  ++VFV+
Sbjct: 124 MTGYGSFYQPDYFIDKNIVFVN 145


>EF633444-1|ABR32189.1|  721|Tribolium castaneum heat shock protein
           90 protein.
          Length = 721

 Score = 22.6 bits (46), Expect = 3.4
 Identities = 7/31 (22%), Positives = 18/31 (58%)
 Frame = +2

Query: 413 INTRDNFRDNIAEHVFDMLLERHGSFENYPI 505
           ++ +++  + + EH    ++++H  F  YPI
Sbjct: 181 LHMKEDQTEFLEEHKIKEIVKKHSQFIGYPI 211


>AJ415419-1|CAC94468.1|  441|Tribolium castaneum transcription
           factor protein.
          Length = 441

 Score = 21.4 bits (43), Expect = 7.8
 Identities = 9/27 (33%), Positives = 15/27 (55%)
 Frame = -1

Query: 353 STFGSFWFSDTFIWPSLVFVSALMTCT 273
           S +GS++     I+P++     L TCT
Sbjct: 230 SQYGSWFLPHQPIYPAVTATVQLSTCT 256


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 159,849
Number of Sequences: 336
Number of extensions: 3363
Number of successful extensions: 8
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 19571740
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -