Samia BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= I09A02NGRL0001_D15
         (591 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U09586-1|AAC47270.1|  425|Tribolium castaneum ORF 1 protein.           24   1.1  
AJ415419-1|CAC94468.1|  441|Tribolium castaneum transcription fa...    22   3.4  

>U09586-1|AAC47270.1|  425|Tribolium castaneum ORF 1 protein.
          Length = 425

 Score = 23.8 bits (49), Expect = 1.1
 Identities = 10/31 (32%), Positives = 16/31 (51%)
 Frame = +3

Query: 387 MQERITTTKAGSITSVQAVYVPADDLTDPAP 479
           +Q R +T+ A  +   Q   +P+D  T P P
Sbjct: 52  LQVRPSTSAAADVDGWQVTPLPSDGTTSPEP 82


>AJ415419-1|CAC94468.1|  441|Tribolium castaneum transcription
           factor protein.
          Length = 441

 Score = 22.2 bits (45), Expect = 3.4
 Identities = 8/12 (66%), Positives = 10/12 (83%)
 Frame = +3

Query: 102 YHEMKVGGVITD 137
           YH+ +VGGVI D
Sbjct: 402 YHQNEVGGVIDD 413


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 150,427
Number of Sequences: 336
Number of extensions: 3539
Number of successful extensions: 3
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 122,585
effective HSP length: 54
effective length of database: 104,441
effective search space used: 14830622
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)