SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20083
         (676 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC6G10.08 |idp1||isocitrate dehydrogenase Idp1|Schizosaccharom...   126   3e-30
SPAC688.04c |gst3||glutathione S-transferase |Schizosaccharomyce...    27   1.9  
SPAC1F5.07c |hem14||protoporphyrinogen oxidase|Schizosaccharomyc...    27   1.9  
SPAC23C11.15 |pst2||Clr6 histone deacetylase complex subunit Pst...    25   7.6  
SPAC2F3.10 |||GARP complex subunit Vps54 |Schizosaccharomyces po...    25   7.6  

>SPAC6G10.08 |idp1||isocitrate dehydrogenase
           Idp1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 418

 Score =  126 bits (304), Expect = 3e-30
 Identities = 53/84 (63%), Positives = 70/84 (83%)
 Frame = +1

Query: 256 DGDEMTRIMWAKIKERLIFPYVKVDCLYFDLGLPHRDATDDQVTIDSAHAILKHNVGIKC 435
           DGDEMTR++W  I+E+L+ PY+ +   Y+DLG+  RD T+DQ+T+D+A AILK++VGIKC
Sbjct: 24  DGDEMTRVIWKIIREKLVLPYMDIKLDYYDLGIEARDKTNDQITVDAAKAILKNDVGIKC 83

Query: 436 ATITPDEQRVEEFKLKKMWLSPNG 507
           ATITPDE RV+E+ LKKMW SPNG
Sbjct: 84  ATITPDEARVKEYNLKKMWKSPNG 107



 Score = 90.2 bits (214), Expect = 2e-19
 Identities = 39/59 (66%), Positives = 45/59 (76%)
 Frame = +3

Query: 498 PERKIRNILGGTVFREPILCQSIPRVVPGWTKPIVIGRHAHGDQYKAQDFVVPKPGKVE 674
           P   IRNIL GTVFREPIL ++IP+ +PGWT PI IGRHA GDQYK+ D V   PGK+E
Sbjct: 105 PNGTIRNILNGTVFREPILIKNIPKYIPGWTNPICIGRHAFGDQYKSTDLVASGPGKLE 163


>SPAC688.04c |gst3||glutathione S-transferase |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 242

 Score = 27.5 bits (58), Expect = 1.9
 Identities = 14/41 (34%), Positives = 22/41 (53%)
 Frame = +1

Query: 373 DDQVTIDSAHAILKHNVGIKCATITPDEQRVEEFKLKKMWL 495
           DD VT   + AIL+H V     +  P E+ V E +  ++W+
Sbjct: 56  DDGVTYIESAAILEHLVRKYGPSFKPSEEDVAELEKYELWM 96


>SPAC1F5.07c |hem14||protoporphyrinogen oxidase|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 490

 Score = 27.5 bits (58), Expect = 1.9
 Identities = 13/25 (52%), Positives = 17/25 (68%)
 Frame = -3

Query: 317 YGNISLSLILAHMMRVISSPSSRQL 243
           YGNI+L LI A + R I SP+ + L
Sbjct: 201 YGNITLGLIRALLAREILSPAEKAL 225


>SPAC23C11.15 |pst2||Clr6 histone deacetylase complex subunit
           Pst2|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1075

 Score = 25.4 bits (53), Expect = 7.6
 Identities = 23/79 (29%), Positives = 34/79 (43%), Gaps = 8/79 (10%)
 Frame = +1

Query: 346 LGLPHRDATDDQV----TIDSAHAILKHNVGIKCAT----ITPDEQRVEEFKLKKMWLSP 501
           LGLP +      +    T + A  + K    + C T    I+  E++ EE+K  K  L P
Sbjct: 441 LGLPSKSIYKKTIKLVYTSEHAEEMFKALERMPCLTLPLVISRLEEKNEEWKSVKRSLQP 500

Query: 502 NGRSVTFWAVQYSANRYCV 558
             RS+ F     S +  CV
Sbjct: 501 GWRSIEFKNYDKSLDSQCV 519


>SPAC2F3.10 |||GARP complex subunit Vps54 |Schizosaccharomyces
            pombe|chr 1|||Manual
          Length = 949

 Score = 25.4 bits (53), Expect = 7.6
 Identities = 17/78 (21%), Positives = 36/78 (46%)
 Frame = +1

Query: 292  IKERLIFPYVKVDCLYFDLGLPHRDATDDQVTIDSAHAILKHNVGIKCATITPDEQRVEE 471
            ++ER+     ++  L +D+  PH    D   ++   + +L       C  + PD  R+ E
Sbjct: 833  MRERVAISCSQIASLSWDIDSPHGYIIDLSKSLIKLYKVLHRYSQRDCVEVIPDVIRMFE 892

Query: 472  FKLKKMWLSPNGRSVTFW 525
             +L ++ L+   R+ + W
Sbjct: 893  DRL-QLELTDIARNPSKW 909


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,743,586
Number of Sequences: 5004
Number of extensions: 54455
Number of successful extensions: 137
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 133
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 137
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 309878492
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -