SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20081
         (635 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC660.15 |||mRNA cleavage factor complex subunit |Schizosaccha...    89   4e-19
SPAC3G6.04 |rnp24||RNA-binding protein Rnp24|Schizosaccharomyces...    59   6e-10
SPAC140.02 |gar2||GAR family|Schizosaccharomyces pombe|chr 1|||M...    57   2e-09
SPBC16E9.12c |pab2||poly|Schizosaccharomyces pombe|chr 2|||Manual      50   2e-07
SPAC16E8.06c |nop12||RNA-binding protein Nop12|Schizosaccharomyc...    50   2e-07
SPBC660.11 |tcg1|mug187|single-stranded telomeric binding protei...    50   2e-07
SPBC365.04c |||RNA-binding protein|Schizosaccharomyces pombe|chr...    49   5e-07
SPAC25G10.01 ||SPAC2C4.18|RNA-binding protein|Schizosaccharomyce...    47   3e-06
SPBC4F6.14 |||RNA-binding protein|Schizosaccharomyces pombe|chr ...    46   3e-06
SPAC57A7.04c |pabp||mRNA export shuttling protein |Schizosacchar...    46   3e-06
SPBP22H7.02c |||RNA-binding protein Mrd1 |Schizosaccharomyces po...    46   5e-06
SPAC19A8.13 |usp101|snp1|U1 snRNP-associated protein Usp101 |Sch...    46   6e-06
SPBC18H10.04c |sce3|tif48|translation initiation factor eIF4B|Sc...    45   8e-06
SPCC306.04c |set1||histone lysine methyltransferase Set1|Schizos...    44   2e-05
SPBC18H10.03 |tif35||translation initiation factor eIF3g|Schizos...    44   2e-05
SPBC887.05c |cwf29||RNA-binding protein Cwf29|Schizosaccharomyce...    43   3e-05
SPAC22E12.02 |||RNA-binding protein|Schizosaccharomyces pombe|ch...    43   3e-05
SPBC3B9.11c |ctf1||mRNA cleavage and polyadenylation specificity...    42   6e-05
SPAC328.05 |||RNA-binding protein involved in export of mRNAs|Sc...    42   1e-04
SPCC1827.05c |||nucleolar RNA-binding protein NIFK |Schizosaccha...    41   2e-04
SPAC31G5.01 |sap49|SPAPB1A11.05|RNA-binding protein Sap49|Schizo...    41   2e-04
SPBC17G9.05 |rct1|cyp6|RRM-containing cyclophilin regulating tra...    39   5e-04
SPBC29A3.07c |||U2 snRNP-associated protein Sf3b14 homolog |Schi...    39   7e-04
SPBC13A2.01c |||nuclear cap-binding complex small subunit|Schizo...    39   7e-04
SPAC17A2.09c |csx1||RNA-binding protein Csx1|Schizosaccharomyces...    38   0.001
SPBC1861.04c |||RNA-binding protein Prp24|Schizosaccharomyces po...    38   0.002
SPAC19G12.07c |rsd1||RNA-binding protein Rsd1|Schizosaccharomyce...    37   0.002
SPAC644.16 |||RNA-binding protein|Schizosaccharomyces pombe|chr ...    36   0.004
SPBC13G1.14c |||RNA-binding protein|Schizosaccharomyces pombe|ch...    36   0.005
SPBC23E6.01c ||SPBPJ758.01|RNA-binding protein, rrm type|Schizos...    36   0.006
SPAC1610.03c |crp79|meu5|poly|Schizosaccharomyces pombe|chr 1|||...    34   0.015
SPBC106.12c |||THO complex subunit |Schizosaccharomyces pombe|ch...    33   0.026
SPBP16F5.06 |||ribosome biogenesis protein Nop6|Schizosaccharomy...    33   0.026
SPAC343.07 |mug28||RNA-binding protein Mug28|Schizosaccharomyces...    32   0.060
SPBC29A10.02 |spo5|mrb1, mug12, SPBC365.18|meiotic RNA-binding p...    32   0.060
SPBC1D7.04 |mlo3||RNA annealing factor Mlo3|Schizosaccharomyces ...    31   0.11 
SPBC146.07 |prp2|mis11|U2AF large subunit |Schizosaccharomyces p...    31   0.14 
SPAC23A1.09 |||RNA-binding protein|Schizosaccharomyces pombe|chr...    31   0.14 
SPBC902.04 |||RNA-binding protein|Schizosaccharomyces pombe|chr ...    31   0.14 
SPCC10H11.02 |cwf23|SPCP31B10.01|DNAJ domain protein Cwf23|Schiz...    30   0.24 
SPCC74.09 |mug24||RNA-binding protein, rrm type|Schizosaccharomy...    30   0.24 
SPCC550.02c |cwf5|ecm2|RNA-binding protein Cwf5|Schizosaccharomy...    29   0.74 
SPAC1952.05 |gcn5||histone acetyltransferase Gcn5|Schizosaccharo...    27   1.7  
SPCC285.14 |||TRAPP complex subunit Trs130 |Schizosaccharomyces ...    27   1.7  
SPAC2F7.11 |nrd1|msa2|RNA-binding protein Nrd1|Schizosaccharomyc...    27   3.0  
SPAC1F5.04c |cdc12||formin Cdc12|Schizosaccharomyces pombe|chr 1...    27   3.0  
SPBC543.05c |||inorganic anion exchanger |Schizosaccharomyces po...    26   5.2  
SPAC16.02c |srp2||mRNA export factor Srp2|Schizosaccharomyces po...    26   5.2  
SPAC222.09 |seb1||RNA-binding protein Seb1 |Schizosaccharomyces ...    25   6.9  
SPAC2F7.09c |||sequence orphan|Schizosaccharomyces pombe|chr 1||...    25   6.9  
SPBC649.05 |cut12|stf1|spindle pole body protein Cut12 |Schizosa...    25   9.1  
SPBC1289.12 |usp109||U1 snRNP-associated protein Usp109|Schizosa...    25   9.1  
SPBC23E6.04c |utp10||U3 snoRNP-associated protein Utp10 |Schizos...    25   9.1  

>SPBC660.15 |||mRNA cleavage factor complex subunit
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 474

 Score = 89.4 bits (212), Expect = 4e-19
 Identities = 39/78 (50%), Positives = 55/78 (70%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+F+GGL+WETTD  LRD+F  +GE+    V  D  TGRSRGF F+ FK P+ +++VM+ 
Sbjct: 164 KMFIGGLNWETTDDSLRDYFEQFGEVLDCTVMRDSTTGRSRGFGFLTFKNPKCVNEVMSK 223

Query: 190 GEHTINNKKVDPKKAKAR 243
            EH ++ K +DPK+A  R
Sbjct: 224 -EHHLDGKIIDPKRAIPR 240



 Score = 82.2 bits (194), Expect = 6e-17
 Identities = 37/87 (42%), Positives = 56/87 (64%)
 Frame = +3

Query: 222 PKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESE 401
           P+E    T + FVGG+  + +++E RNFF++FG +L+  +  DK   + +GF F+T+E+E
Sbjct: 239 PREEQEKTAKMFVGGVPGDCTEEEFRNFFNQFGRVLDATLMMDKDTGRPRGFGFVTYENE 298

Query: 402 QVVNDLLKTPKRTIGGKEVDVKRATPK 482
             V   +  P  TI GK V+VKRATPK
Sbjct: 299 SAVEATMSQPYITIHGKPVEVKRATPK 325



 Score = 66.9 bits (156), Expect = 2e-12
 Identities = 28/78 (35%), Positives = 53/78 (67%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           F+GGL+ E +DD +R++F +FG +L+  +  D T  + +GF F+TF++ + VN+++ + +
Sbjct: 166 FIGGLNWETTDDSLRDYFEQFGEVLDCTVMRDSTTGRSRGFGFLTFKNPKCVNEVM-SKE 224

Query: 435 RTIGGKEVDVKRATPKPD 488
             + GK +D KRA P+ +
Sbjct: 225 HHLDGKIIDPKRAIPREE 242



 Score = 59.7 bits (138), Expect = 3e-10
 Identities = 25/75 (33%), Positives = 45/75 (60%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           K+FVGG+  + T++E R+ F  +G +    +  D +TGR RGF F+ ++   +++  M+ 
Sbjct: 248 KMFVGGVPGDCTEEEFRNFFNQFGRVLDATLMMDKDTGRPRGFGFVTYENESAVEATMSQ 307

Query: 190 GEHTINNKKVDPKKA 234
              TI+ K V+ K+A
Sbjct: 308 PYITIHGKPVEVKRA 322


>SPAC3G6.04 |rnp24||RNA-binding protein Rnp24|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 369

 Score = 58.8 bits (136), Expect = 6e-10
 Identities = 25/63 (39%), Positives = 40/63 (63%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           LFVG L +ETTD +L++HFG  G+I  + + T  +TG+ +GF F+ F   ++  K M  G
Sbjct: 230 LFVGNLDFETTDADLKEHFGQVGQIRRVRLMTFEDTGKCKGFGFVDFPDIDTCMKAMELG 289

Query: 193 EHT 201
            ++
Sbjct: 290 HNS 292



 Score = 32.3 bits (70), Expect = 0.060
 Identities = 15/46 (32%), Positives = 24/46 (52%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF 392
           FVG L  E +D +++  F + G I  V +   +   + KGF F+ F
Sbjct: 231 FVGNLDFETTDADLKEHFGQVGQIRRVRLMTFEDTGKCKGFGFVDF 276


>SPAC140.02 |gar2||GAR family|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 500

 Score = 56.8 bits (131), Expect = 2e-09
 Identities = 25/66 (37%), Positives = 39/66 (59%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           + +FVG LS+  T+ +L   FG  G+I+SI + TDP +GR +GF ++ F   +S  K + 
Sbjct: 366 DTVFVGNLSFNATEDDLSTAFGGCGDIQSIRLPTDPQSGRLKGFGYVTFSDIDSAKKCVE 425

Query: 187 AGEHTI 204
              H I
Sbjct: 426 MNGHFI 431



 Score = 51.6 bits (118), Expect = 9e-08
 Identities = 26/71 (36%), Positives = 39/71 (54%), Gaps = 1/71 (1%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA- 189
           +FVG LSW   D+ L   F  YG I    V  D  +GRS+G+ ++ F+ PE+    +AA 
Sbjct: 265 VFVGRLSWNVDDQWLGQEFEEYGTIVGARVIMDGQSGRSKGYGYVDFETPEAAKAAVAAN 324

Query: 190 GEHTINNKKVD 222
           G   I+ + V+
Sbjct: 325 GTKEIDGRMVN 335



 Score = 46.0 bits (104), Expect = 5e-06
 Identities = 24/94 (25%), Positives = 46/94 (48%), Gaps = 1/94 (1%)
 Frame = +3

Query: 216 SRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFE 395
           ++P +  + T   FVG LS  + D  +   F E+GTI+   +  D    + KG+ ++ FE
Sbjct: 253 TKPSQDSNETCTVFVGRLSWNVDDQWLGQEFEEYGTIVGARVIMDGQSGRSKGYGYVDFE 312

Query: 396 SEQVVN-DLLKTPKRTIGGKEVDVKRATPKPDGP 494
           + +     +     + I G+ V++  + P+P  P
Sbjct: 313 TPEAAKAAVAANGTKEIDGRMVNLDLSNPRPANP 346



 Score = 42.7 bits (96), Expect = 4e-05
 Identities = 21/79 (26%), Positives = 36/79 (45%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FVG LS   ++D++   F   G I  + +P D    + KGF ++TF         ++   
Sbjct: 369 FVGNLSFNATEDDLSTAFGGCGDIQSIRLPTDPQSGRLKGFGYVTFSDIDSAKKCVEMNG 428

Query: 435 RTIGGKEVDVKRATPKPDG 491
             I G+   +  +TP+  G
Sbjct: 429 HFIAGRPCRLDFSTPRTGG 447


>SPBC16E9.12c |pab2||poly|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 166

 Score = 50.4 bits (115), Expect = 2e-07
 Identities = 21/77 (27%), Positives = 40/77 (51%), Gaps = 2/77 (2%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           + ++VG + +  T +EL+ HF + G +  + +  D  TG  +GFA+I F  P  +   + 
Sbjct: 55  QSVYVGNVDYSVTPEELQSHFASCGSVNRVTILCDKFTGHPKGFAYIEFSEPSLVPNALL 114

Query: 187 AGEHTINNK--KVDPKK 231
                ++ +  KV PK+
Sbjct: 115 LNGSMLHERPLKVTPKR 131



 Score = 35.1 bits (77), Expect = 0.009
 Identities = 15/56 (26%), Positives = 30/56 (53%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLL 422
           +VG +   ++ +E+++ F+  G++  V +  DK     KGF +I F    +V + L
Sbjct: 58  YVGNVDYSVTPEELQSHFASCGSVNRVTILCDKFTGHPKGFAYIEFSEPSLVPNAL 113


>SPAC16E8.06c |nop12||RNA-binding protein Nop12|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 438

 Score = 50.4 bits (115), Expect = 2e-07
 Identities = 22/61 (36%), Positives = 35/61 (57%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           +FVG L++E  ++ L  +FG  G I+ + +  DP T   +GFA+I FK    +DK +   
Sbjct: 272 VFVGNLAFEAEEEPLWRYFGDCGSIDYVRIVRDPKTNLGKGFAYIQFKDTMGVDKALLLN 331

Query: 193 E 195
           E
Sbjct: 332 E 332



 Score = 39.1 bits (87), Expect = 5e-04
 Identities = 25/79 (31%), Positives = 41/79 (51%), Gaps = 2/79 (2%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVND-LLKTP 431
           FVG L+ E  ++ +  +F + G+I  V +  D   N  KGF +I F+    V+  LL   
Sbjct: 273 FVGNLAFEAEEEPLWRYFGDCGSIDYVRIVRDPKTNLGKGFAYIQFKDTMGVDKALLLNE 332

Query: 432 KRTIGGKEVDVKRA-TPKP 485
           K+   G+ + + RA + KP
Sbjct: 333 KKMPEGRTLRIMRAKSTKP 351


>SPBC660.11 |tcg1|mug187|single-stranded telomeric binding protein
           Tgc1 |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 348

 Score = 50.4 bits (115), Expect = 2e-07
 Identities = 28/104 (26%), Positives = 54/104 (51%), Gaps = 5/104 (4%)
 Frame = +3

Query: 198 HHQQQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRK-- 371
           H   ++S      +  +  FVG LS+     EIR+ F   GT+ +V +PF + +   +  
Sbjct: 28  HASAEQSNTPAQQADDFRVFVGRLSTSTKKSEIRSLFETVGTVRKVTIPFRRVRRGTRLV 87

Query: 372 --GFCFITFESEQVVNDLLKTPK-RTIGGKEVDVKRATPKPDGP 494
             G  F+TF +++ V+  ++T   +T+  +E+ V++A P  + P
Sbjct: 88  PSGIAFVTFNNQEDVDKAIETLNGKTLDDREIVVQKARPVQEQP 131



 Score = 35.9 bits (79), Expect = 0.005
 Identities = 23/89 (25%), Positives = 40/89 (44%), Gaps = 4/89 (4%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSR----GFAFIVFKAPESIDK 177
           ++FVG LS  T   E+R  F   G +  + +        +R    G AF+ F   E +DK
Sbjct: 45  RVFVGRLSTSTKKSEIRSLFETVGTVRKVTIPFRRVRRGTRLVPSGIAFVTFNNQEDVDK 104

Query: 178 VMAAGEHTINNKKVDPKKAKARHGKILSE 264
            +     T+N K +D ++   +  + + E
Sbjct: 105 AI----ETLNGKTLDDREIVVQKARPVQE 129


>SPBC365.04c |||RNA-binding protein|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 233

 Score = 49.2 bits (112), Expect = 5e-07
 Identities = 29/97 (29%), Positives = 53/97 (54%), Gaps = 3/97 (3%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES--IDKVMA 186
           LFVG L  +++ + L+ HF   G++ S+ + TD  +GR +G+AF+ F  P++  I K + 
Sbjct: 94  LFVGNLPKDSSVETLQLHFKRAGQVPSVRIPTDKTSGRQKGYAFVEFINPKTDVISKALK 153

Query: 187 AGEHTI-NNKKVDPKKAKARHGKILSEDSAVKSQMMK 294
              HTI   +K++ +      GK  +  + +K +  K
Sbjct: 154 F-HHTIYKERKINIELTAGGGGKTEARMNKIKEKNRK 189



 Score = 38.3 bits (85), Expect = 0.001
 Identities = 16/46 (34%), Positives = 26/46 (56%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF 392
           FVG L  + S + ++  F   G +  V +P DKT  ++KG+ F+ F
Sbjct: 95  FVGNLPKDSSVETLQLHFKRAGQVPSVRIPTDKTSGRQKGYAFVEF 140


>SPAC25G10.01 ||SPAC2C4.18|RNA-binding protein|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 297

 Score = 46.8 bits (106), Expect = 3e-06
 Identities = 29/103 (28%), Positives = 54/103 (52%), Gaps = 5/103 (4%)
 Frame = +3

Query: 204 QQQESRPKEG*STTWED-FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFC 380
           ++ +S P EG      D FV G++S + +DE++  FS+FGT+  V +  +      +GF 
Sbjct: 87  KEPQSAP-EGSENLGNDLFVSGIASRMQEDELQQIFSKFGTVTHVRIMREPVTKASRGFG 145

Query: 381 FITFES-EQVVNDLLKTPKRTIGGKEVDV---KRATPKPDGPG 497
           F++F + E+  + +     +   G+ ++V   KR+ P    PG
Sbjct: 146 FLSFSTVEEATSAIDNLNSQEFYGRVLNVQKAKRSRPHSPTPG 188



 Score = 39.5 bits (88), Expect = 4e-04
 Identities = 17/51 (33%), Positives = 27/51 (52%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 165
           LFV G++    + EL+  F  +G +  + +  +P T  SRGF F+ F   E
Sbjct: 103 LFVSGIASRMQEDELQQIFSKFGTVTHVRIMREPVTKASRGFGFLSFSTVE 153


>SPBC4F6.14 |||RNA-binding protein|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 674

 Score = 46.4 bits (105), Expect = 3e-06
 Identities = 33/97 (34%), Positives = 49/97 (50%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           LFV  L+++T   +L + F   G I+   V T+P TG +RG+ F+ F   E  D   AA 
Sbjct: 7   LFVRNLAFQTKQDDLTNFFSDVGPIKHAVVVTNPETGENRGYGFVTFSMLE--DAQRAAK 64

Query: 193 EHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKSET 303
           E  + NKK+        HG+IL  D A   +  + +T
Sbjct: 65  E--LKNKKL--------HGRILRLDFATPRKRSEVDT 91



 Score = 39.9 bits (89), Expect = 3e-04
 Identities = 19/50 (38%), Positives = 29/50 (58%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFK 156
           + +FV  L +E T++EL +HF  +G +    +  DP T RS G  FI F+
Sbjct: 277 DTVFVRNLLFECTEQELYNHFRQFGPLAYAKLVKDPATDRSLGRGFIKFR 326



 Score = 36.3 bits (80), Expect = 0.004
 Identities = 20/77 (25%), Positives = 38/77 (49%), Gaps = 1/77 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           FV  L+ +   D++ NFFS+ G I    +  +    + +G+ F+TF   +      K  K
Sbjct: 8   FVRNLAFQTKQDDLTNFFSDVGPIKHAVVVTNPETGENRGYGFVTFSMLEDAQRAAKELK 67

Query: 435 -RTIGGKEVDVKRATPK 482
            + + G+ + +  ATP+
Sbjct: 68  NKKLHGRILRLDFATPR 84


>SPAC57A7.04c |pabp||mRNA export shuttling protein
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 653

 Score = 46.4 bits (105), Expect = 3e-06
 Identities = 21/57 (36%), Positives = 32/57 (56%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 183
           LF+  L  E  D+ L+  F A+G I S  + TD   G+S+GF F+ +  PE  +K +
Sbjct: 366 LFIKNLQDEVDDERLKAEFSAFGTITSAKIMTD-EQGKSKGFGFVCYTTPEEANKAV 421



 Score = 36.7 bits (81), Expect = 0.003
 Identities = 21/64 (32%), Positives = 33/64 (51%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           L+VG L    T+  L + F + G + SI V  D  T RS G+A++ F   E  +K +   
Sbjct: 82  LYVGELDPSVTEAMLFELFNSIGPVASIRVCRDAVTRRSLGYAYVNFHNMEDGEKALDEL 141

Query: 193 EHTI 204
            +T+
Sbjct: 142 NYTL 145


>SPBP22H7.02c |||RNA-binding protein Mrd1 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 833

 Score = 46.0 bits (104), Expect = 5e-06
 Identities = 23/77 (29%), Positives = 41/77 (53%), Gaps = 1/77 (1%)
 Frame = +3

Query: 237 STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF-ESEQVVN 413
           S T   F+  L+   ++D++++ F  FG + +V MP DK  N  KGF +I F +++  V 
Sbjct: 320 SETKRLFLRNLTYSCAEDDLKSLFGPFGQLEQVHMPIDKKTNNPKGFAYIDFHDADDAVR 379

Query: 414 DLLKTPKRTIGGKEVDV 464
             L+   +   G+ + V
Sbjct: 380 AYLELDAKPFQGRLLHV 396


>SPAC19A8.13 |usp101|snp1|U1 snRNP-associated protein Usp101
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 261

 Score = 45.6 bits (103), Expect = 6e-06
 Identities = 19/51 (37%), Positives = 33/51 (64%)
 Frame = +1

Query: 4   HEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFK 156
           ++ +F+  LS++T + ++   F  YG IE I V  +  TG+S G+AF+VF+
Sbjct: 99  YKTMFLSRLSYDTKESDIEREFTRYGPIERIRVVRNKVTGKSMGYAFVVFE 149


>SPBC18H10.04c |sce3|tif48|translation initiation factor
           eIF4B|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 388

 Score = 45.2 bits (102), Expect = 8e-06
 Identities = 26/84 (30%), Positives = 42/84 (50%)
 Frame = +1

Query: 19  VGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEH 198
           VG LS++ T+ +L D FG    + SI +  DP T RSRGF ++ F+  +++   +A    
Sbjct: 98  VGNLSFDLTENDLGDFFGE--GVTSIRLVIDPLTERSRGFGYVEFETADTLSAALALSGE 155

Query: 199 TINNKKVDPKKAKARHGKILSEDS 270
            +  + V    A+ R      E S
Sbjct: 156 DLMGRPVRITVAEPRRSFAREERS 179



 Score = 36.3 bits (80), Expect = 0.004
 Identities = 17/75 (22%), Positives = 39/75 (52%)
 Frame = +3

Query: 258 VGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKR 437
           VG LS +++++++ +FF E   +  + +  D    + +GF ++ FE+   ++  L     
Sbjct: 98  VGNLSFDLTENDLGDFFGE--GVTSIRLVIDPLTERSRGFGYVEFETADTLSAALALSGE 155

Query: 438 TIGGKEVDVKRATPK 482
            + G+ V +  A P+
Sbjct: 156 DLMGRPVRITVAEPR 170


>SPCC306.04c |set1||histone lysine methyltransferase
           Set1|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 920

 Score = 44.0 bits (99), Expect = 2e-05
 Identities = 37/132 (28%), Positives = 63/132 (47%), Gaps = 1/132 (0%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           ++FV  +S   T ++LR HF ++GE+  +++K +P TG S G   I F    SI   +AA
Sbjct: 95  QVFVSNISPLVTSEQLRYHFKSFGEVFDLDLKLNPYTGTSLGLCCISFDKRSSIS--VAA 152

Query: 190 GEHTINNKKVDPKKAKARH-GKILSEDSAVKSQMMKSETSSVNLELS*KWRCPLTKQRTK 366
               I  ++ +  +   +    +L  D ++  +  K   ++V  +   +    L KQR  
Sbjct: 153 HSAKIAVQQANGLRFSGKPLSVVLDRDGSLCEEAFKKALNAVEKQFQEE---TLQKQRF- 208

Query: 367 ERASVSSHLNLS 402
           ER   SS   LS
Sbjct: 209 EREDESSRQKLS 220



 Score = 32.7 bits (71), Expect = 0.046
 Identities = 11/53 (20%), Positives = 27/53 (50%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVN 413
           FV  +S  ++ +++R  F  FG + ++++  +       G C I+F+    ++
Sbjct: 97  FVSNISPLVTSEQLRYHFKSFGEVFDLDLKLNPYTGTSLGLCCISFDKRSSIS 149


>SPBC18H10.03 |tif35||translation initiation factor
           eIF3g|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 282

 Score = 43.6 bits (98), Expect = 2e-05
 Identities = 20/47 (42%), Positives = 31/47 (65%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 153
           L V  LS +T ++ELRD F  +G I+ + +  D  TGR++GFAF+ +
Sbjct: 204 LRVTNLSDDTREEELRDLFRRFGGIQRVYLAKDKETGRAKGFAFVSY 250



 Score = 37.5 bits (83), Expect = 0.002
 Identities = 16/45 (35%), Positives = 26/45 (57%)
 Frame = +3

Query: 258 VGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF 392
           V  LS +  ++E+R+ F  FG I  V +  DK   + KGF F+++
Sbjct: 206 VTNLSDDTREEELRDLFRRFGGIQRVYLAKDKETGRAKGFAFVSY 250


>SPBC887.05c |cwf29||RNA-binding protein Cwf29|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 217

 Score = 43.2 bits (97), Expect = 3e-05
 Identities = 16/50 (32%), Positives = 32/50 (64%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQ 404
           ++G L  ++++D+I   FSEFG  +++ +  DK   + KGF F+ +E ++
Sbjct: 34  YIGNLDFDLNEDDILCVFSEFGEPVDINLVRDKETGKSKGFAFLKYEDQR 83



 Score = 40.3 bits (90), Expect = 2e-04
 Identities = 16/52 (30%), Positives = 31/52 (59%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 168
           +++G L ++  + ++   F  +GE   IN+  D  TG+S+GFAF+ ++   S
Sbjct: 33  IYIGNLDFDLNEDDILCVFSEFGEPVDINLVRDKETGKSKGFAFLKYEDQRS 84


>SPAC22E12.02 |||RNA-binding protein|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 219

 Score = 43.2 bits (97), Expect = 3e-05
 Identities = 21/75 (28%), Positives = 47/75 (62%), Gaps = 1/75 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF-ESEQVVNDLLKTP 431
           FVG L ++++D+ +   FSE+ ++++ ++  D+ + + +GF F++F +S+Q +    +  
Sbjct: 33  FVGNLGNDVNDESLYQAFSEYPSLVKTKVVRDR-EGKTRGFGFVSFKDSDQFLKAWREKN 91

Query: 432 KRTIGGKEVDVKRAT 476
            + IG + V + RAT
Sbjct: 92  GKYIGSRPVKLSRAT 106



 Score = 37.9 bits (84), Expect = 0.001
 Identities = 19/51 (37%), Positives = 26/51 (50%)
 Frame = +1

Query: 4   HEKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFK 156
           H +LFVG L  +  D+ L   F  Y  +    V  D   G++RGF F+ FK
Sbjct: 29  HFRLFVGNLGNDVNDESLYQAFSEYPSLVKTKVVRD-REGKTRGFGFVSFK 78


>SPBC3B9.11c |ctf1||mRNA cleavage and polyadenylation specificity
           factor complex subunit Ctf1|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 363

 Score = 42.3 bits (95), Expect = 6e-05
 Identities = 18/75 (24%), Positives = 40/75 (53%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           +FVG + ++ +++++ + F   G +++  +  DP TG  +G+ F  F   E+     A  
Sbjct: 9   VFVGNIPYDVSEQQMTEIFNQVGPVKTFKLVLDPETGSGKGYGFCEFFDSET----TAMA 64

Query: 193 EHTINNKKVDPKKAK 237
              +NN ++ P+K +
Sbjct: 65  VRKLNNSELGPRKIR 79



 Score = 33.5 bits (73), Expect = 0.026
 Identities = 17/78 (21%), Positives = 37/78 (47%), Gaps = 1/78 (1%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFIT-FESEQVVNDLLKTP 431
           FVG +  ++S+ ++   F++ G +   ++  D      KG+ F   F+SE     + K  
Sbjct: 10  FVGNIPYDVSEQQMTEIFNQVGPVKTFKLVLDPETGSGKGYGFCEFFDSETTAMAVRKLN 69

Query: 432 KRTIGGKEVDVKRATPKP 485
              +G +++ V+  +  P
Sbjct: 70  NSELGPRKIRVEFPSNDP 87


>SPAC328.05 |||RNA-binding protein involved in export of
           mRNAs|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 434

 Score = 41.5 bits (93), Expect = 1e-04
 Identities = 22/60 (36%), Positives = 34/60 (56%), Gaps = 4/60 (6%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFK----APESIDKV 180
           ++VG L W T+D+ L D F   G +    +  +P TGRS+GF  + F+    A  SI+K+
Sbjct: 282 IYVGNLPWATSDRNLLDLFTDIGSVIRARIAYEP-TGRSKGFGVVQFENENDAASSIEKL 340


>SPCC1827.05c |||nucleolar RNA-binding protein NIFK
           |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 276

 Score = 40.7 bits (91), Expect = 2e-04
 Identities = 19/58 (32%), Positives = 32/58 (55%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKT 428
           +VG L     + ++R +FS+FG +L + M  ++     K + FI FES  V N + +T
Sbjct: 108 YVGRLPHGFYEKQMRMYFSQFGPVLRLRMSRNRKTGSSKHYAFIEFESLDVANVVAET 165


>SPAC31G5.01 |sap49|SPAPB1A11.05|RNA-binding protein
           Sap49|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 335

 Score = 40.7 bits (91), Expect = 2e-04
 Identities = 27/82 (32%), Positives = 42/82 (51%), Gaps = 2/82 (2%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGE-IESINVKTDPNTGRSRGFAFIVFKAPESID-KVMA 186
           LFVG L     ++ L D F A G+ +++  V  D N GRS+G+ F+ + + E+ D  + A
Sbjct: 101 LFVGNLDPLVDERVLYDTFSALGQLVKAPQVARDEN-GRSKGYGFVSYDSFETADAAIEA 159

Query: 187 AGEHTINNKKVDPKKAKARHGK 252
                + NK +    A  R GK
Sbjct: 160 MNNQFLMNKPITVSYAFKREGK 181



 Score = 26.2 bits (55), Expect = 4.0
 Identities = 11/48 (22%), Positives = 24/48 (50%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFES 398
           FVG L   + +  + + FS  G +++          + KG+ F++++S
Sbjct: 102 FVGNLDPLVDERVLYDTFSALGQLVKAPQVARDENGRSKGYGFVSYDS 149


>SPBC17G9.05 |rct1|cyp6|RRM-containing cyclophilin regulating
           transcription Rct1|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 432

 Score = 39.1 bits (87), Expect = 5e-04
 Identities = 23/55 (41%), Positives = 31/55 (56%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDK 177
           LFV  L+  T D++L   F  +G+I S  V  D  TG S  +AFI F   ES++K
Sbjct: 246 LFVCKLNPVTQDEDLELIFSRFGKIISCQVIRDKETGDSLQYAFIEFDNKESVEK 300


>SPBC29A3.07c |||U2 snRNP-associated protein Sf3b14 homolog
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 137

 Score = 38.7 bits (86), Expect = 7e-04
 Identities = 19/48 (39%), Positives = 31/48 (64%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFK 156
           LF+  LS++ T +E+ D FG YG +  I +    NT ++RG AF+V++
Sbjct: 14  LFIKNLSFKITAEEMYDLFGRYGPVRQIRL---GNTVQTRGTAFVVYE 58


>SPBC13A2.01c |||nuclear cap-binding complex small
           subunit|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 182

 Score = 38.7 bits (86), Expect = 7e-04
 Identities = 21/62 (33%), Positives = 31/62 (50%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK 434
           +VG LS   ++++I   FS+ G I  + M  D+      GFCF+ +   Q   D LK   
Sbjct: 35  YVGNLSFYTTEEQIYALFSKCGEIRRIIMGVDRFTKTPCGFCFVEYFENQDALDSLKYIS 94

Query: 435 RT 440
           RT
Sbjct: 95  RT 96



 Score = 33.5 bits (73), Expect = 0.026
 Identities = 21/80 (26%), Positives = 41/80 (51%), Gaps = 1/80 (1%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFI-VFKAPESIDKVMAA 189
           ++VG LS+ TT++++   F   GEI  I +  D  T    GF F+  F+  +++D +   
Sbjct: 34  VYVGNLSFYTTEEQIYALFSKCGEIRRIIMGVDRFTKTPCGFCFVEYFENQDALDSLKYI 93

Query: 190 GEHTINNKKVDPKKAKARHG 249
              +++ + +   +A   HG
Sbjct: 94  SRTSLDERII---RADLDHG 110


>SPAC17A2.09c |csx1||RNA-binding protein Csx1|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 632

 Score = 37.9 bits (84), Expect = 0.001
 Identities = 15/33 (45%), Positives = 24/33 (72%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDK 353
           FVGGL+S +S+ +++  F  FG IL +++PF K
Sbjct: 300 FVGGLASNLSEKDLQVCFQPFGRILNIKIPFGK 332


>SPBC1861.04c |||RNA-binding protein Prp24|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 1014

 Score = 37.5 bits (83), Expect = 0.002
 Identities = 16/78 (20%), Positives = 41/78 (52%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 189
           +L+V  + ++  +K++   F  YG++ES+ +    N  + +GF ++V    +  +  ++A
Sbjct: 758 ELYVTNIDFKVNEKDVETFFRDYGQVESVRIPKRFN--QHKGFGYVVMTTNQDAENALSA 815

Query: 190 GEHTINNKKVDPKKAKAR 243
               + N+ ++   +K R
Sbjct: 816 AGKQLGNRVLNVVLSKPR 833


>SPAC19G12.07c |rsd1||RNA-binding protein Rsd1|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 604

 Score = 37.1 bits (82), Expect = 0.002
 Identities = 18/58 (31%), Positives = 30/58 (51%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +FV  L+   T +EL D F   G +    +  D  +GRS+G A++ F   +S+   +A
Sbjct: 242 VFVSQLANRLTSRELYDFFEQAGPVRDAQIVRDKISGRSKGVAYVEFCHEDSVQAAIA 299



 Score = 36.7 bits (81), Expect = 0.003
 Identities = 16/53 (30%), Positives = 34/53 (64%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 168
           +L V  + +  TD++++  F  +G+IE ++++ D +  RS+GF +I ++ P S
Sbjct: 341 RLCVSNIHFNLTDEDVKAIFEPFGDIEFVHLQRD-DQNRSKGFGYIQYRNPIS 392


>SPAC644.16 |||RNA-binding protein|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 422

 Score = 36.3 bits (80), Expect = 0.004
 Identities = 13/50 (26%), Positives = 29/50 (58%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAP 162
           ++VG + +E  ++++ D F   G ++S  +  DP +G+ +G+ F  +  P
Sbjct: 7   VYVGNIPYEMAEEQVIDIFKQSGPVKSFQLVIDPESGQPKGYGFCEYHDP 56



 Score = 29.9 bits (64), Expect = 0.32
 Identities = 10/46 (21%), Positives = 25/46 (54%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF 392
           +VG +  E++++++ + F + G +   ++  D    Q KG+ F  +
Sbjct: 8   YVGNIPYEMAEEQVIDIFKQSGPVKSFQLVIDPESGQPKGYGFCEY 53


>SPBC13G1.14c |||RNA-binding protein|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 243

 Score = 35.9 bits (79), Expect = 0.005
 Identities = 21/74 (28%), Positives = 35/74 (47%), Gaps = 3/74 (4%)
 Frame = +3

Query: 258 VGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITF-ESEQVVNDLLKTPK 434
           V  L+  ++ + I   F  +G I  + MP  K     KG+C+I +   +Q  N + K   
Sbjct: 103 VENLTRNVTKEHIAEIFGIYGLIDHIFMPIYKKSELNKGYCYIEYVYHDQAANAVDKMNN 162

Query: 435 RTIGGKE--VDVKR 470
             + G+E  V +KR
Sbjct: 163 AELDGEELFVSIKR 176


>SPBC23E6.01c ||SPBPJ758.01|RNA-binding protein, rrm
           type|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 473

 Score = 35.5 bits (78), Expect = 0.006
 Identities = 14/30 (46%), Positives = 22/30 (73%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMP 344
           FVGGLS  +S++E++  F  FG I+ V++P
Sbjct: 306 FVGGLSKFVSEEELKYLFQNFGEIVYVKIP 335



 Score = 34.7 bits (76), Expect = 0.011
 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 1/48 (2%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGA-YGEIESINVKTDPNTGRSRGFAFIVF 153
           +FVG LS    + ++   F + Y   +S  + TDP T  SRG+ F+ F
Sbjct: 188 IFVGDLSPNVNEFDVYSLFASRYNSCKSAKIMTDPQTNVSRGYGFVRF 235



 Score = 28.7 bits (61), Expect = 0.74
 Identities = 16/37 (43%), Positives = 23/37 (62%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTG 123
           +FVGGLS   +++EL+  F  +GEI  + VK  P  G
Sbjct: 305 VFVGGLSKFVSEEELKYLFQNFGEI--VYVKIPPGKG 339


>SPAC1610.03c |crp79|meu5|poly|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 710

 Score = 34.3 bits (75), Expect = 0.015
 Identities = 19/64 (29%), Positives = 31/64 (48%)
 Frame = +1

Query: 40  TTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV 219
           T   +L D F  +G I S  +   PN+G S+G+ F+ F+  E+        + T+N   V
Sbjct: 395 TCKSQLEDLFSPFGSILSSMLACYPNSGISKGYGFVAFRQIEA----AVRAKDTLNGMMV 450

Query: 220 DPKK 231
             K+
Sbjct: 451 GKKR 454



 Score = 33.5 bits (73), Expect = 0.026
 Identities = 24/91 (26%), Positives = 44/91 (48%), Gaps = 14/91 (15%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTI-------------LEVEMPFDKTKNQRKGFCFITFE 395
           +VG + S +SD+EI   FS++G +              E   PF   KN  + + F+ F 
Sbjct: 20  YVGNIDSRLSDEEIIKHFSKYGQVESIFRRLLDSFYPKEKAKPFKPPKNGVQ-YGFVKFV 78

Query: 396 SEQVVNDLLKTPK-RTIGGKEVDVKRATPKP 485
           + + + ++LK  K  T+G +++ +K     P
Sbjct: 79  NAESIEEVLKDAKGMTLGQRKLTIKARVVNP 109



 Score = 31.9 bits (69), Expect = 0.080
 Identities = 25/94 (26%), Positives = 42/94 (44%), Gaps = 13/94 (13%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESI----------NVKTDPNTGRSRG--FAFIVFK 156
           ++VG +    +D+E+  HF  YG++ESI            K  P      G  + F+ F 
Sbjct: 19  IYVGNIDSRLSDEEIIKHFSKYGQVESIFRRLLDSFYPKEKAKPFKPPKNGVQYGFVKFV 78

Query: 157 APESIDKVMA-AGEHTINNKKVDPKKAKARHGKI 255
             ESI++V+  A   T+  +K+  K       K+
Sbjct: 79  NAESIEEVLKDAKGMTLGQRKLTIKARVVNPAKL 112


>SPBC106.12c |||THO complex subunit |Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 274

 Score = 33.5 bits (73), Expect = 0.026
 Identities = 20/75 (26%), Positives = 38/75 (50%), Gaps = 1/75 (1%)
 Frame = +3

Query: 258 VGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKR 437
           V  L  ++ + ++ + F  F  I  V M +D+   + +G C + FE+ Q   D  KT + 
Sbjct: 89  VENLHYQVLEKDVLSLFENFHPI-RVIMNYDRA-GRSEGSCDVYFETSQDAEDAQKTLQS 146

Query: 438 T-IGGKEVDVKRATP 479
           T + G E+ + + +P
Sbjct: 147 TNLKGSEIQISKKSP 161


>SPBP16F5.06 |||ribosome biogenesis protein Nop6|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 478

 Score = 33.5 bits (73), Expect = 0.026
 Identities = 20/78 (25%), Positives = 39/78 (50%), Gaps = 3/78 (3%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTK-NQRKGFCFITFESEQVVNDLLKT- 428
           +VGGLSS I   ++ + FS FG++  +E+    T     + F ++ F +++      K+ 
Sbjct: 8   YVGGLSSSIESSDLESRFSRFGSVSNLEIINKSTPVGTIQRFAYLNFRTDEDKWQKCKSY 67

Query: 429 -PKRTIGGKEVDVKRATP 479
               T  G ++ ++ A P
Sbjct: 68  LSNATFKGSKLRIEEARP 85



 Score = 32.3 bits (70), Expect = 0.060
 Identities = 15/55 (27%), Positives = 30/55 (54%), Gaps = 2/55 (3%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINV--KTDPNTGRSRGFAFIVFKAPE 165
           ++++VGGLS      +L   F  +G + ++ +  K+ P  G  + FA++ F+  E
Sbjct: 5   KRIYVGGLSSSIESSDLESRFSRFGSVSNLEIINKSTP-VGTIQRFAYLNFRTDE 58


>SPAC343.07 |mug28||RNA-binding protein Mug28|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 609

 Score = 32.3 bits (70), Expect = 0.060
 Identities = 22/93 (23%), Positives = 43/93 (46%), Gaps = 1/93 (1%)
 Frame = +1

Query: 49  KELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAP-ESIDKVMAAGEHTINNKKVDP 225
           ++L + F  +G I+S  + + P+T  S+G+ F+ F  P E++  +          K++  
Sbjct: 435 QQLEELFSKFGRIKSCTLASYPSTEISKGYGFVSFSHPFEAVQAINTLNGVLFGKKRLFV 494

Query: 226 KKAKARHGKILSEDSAVKSQMMKSETSSVNLEL 324
             A+ R  +     SA+ SQ       S +L +
Sbjct: 495 NYAEKREDR-KKRLSAIFSQSYPPVVPSPSLTI 526



 Score = 25.8 bits (54), Expect = 5.2
 Identities = 16/55 (29%), Positives = 24/55 (43%), Gaps = 6/55 (10%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKG------FCFITFESE 401
           +VG L S     ++   F  FG   +  M   + KN+         F FITFE++
Sbjct: 23  YVGNLPSTCQSSDLHELFEPFGNFSKFHM-LSRKKNKSTDSKSPTLFAFITFENK 76


>SPBC29A10.02 |spo5|mrb1, mug12, SPBC365.18|meiotic RNA-binding
           protein 1|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 567

 Score = 32.3 bits (70), Expect = 0.060
 Identities = 19/68 (27%), Positives = 31/68 (45%)
 Frame = +3

Query: 201 HQQQESRPKEG*STTWEDFVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFC 380
           H  ++S   E  S T   ++ GL    SD+ +  + + FG +   +   D   N  KG+ 
Sbjct: 282 HDNKKSN-MESTSRTRNVYIRGLPPNTSDENLLLYTNRFGKVSSSKAIIDMETNLCKGYG 340

Query: 381 FITFESEQ 404
           F  FE E+
Sbjct: 341 FACFEEEK 348


>SPBC1D7.04 |mlo3||RNA annealing factor Mlo3|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 199

 Score = 31.5 bits (68), Expect = 0.11
 Identities = 16/52 (30%), Positives = 30/52 (57%), Gaps = 1/52 (1%)
 Frame = +1

Query: 10  KLFVGGLSWETTDKELRDHF-GAYGEIESINVKTDPNTGRSRGFAFIVFKAP 162
           K+ V  L  + T+ ++++ F  + G  + +++   PN GRS+G A I+F  P
Sbjct: 56  KIIVSNLPTDVTEAQVKELFVKSIGPCKRVSLAYGPN-GRSKGIATIIFSRP 106


>SPBC146.07 |prp2|mis11|U2AF large subunit |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 517

 Score = 31.1 bits (67), Expect = 0.14
 Identities = 16/71 (22%), Positives = 34/71 (47%), Gaps = 2/71 (2%)
 Frame = +1

Query: 7   EKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 186
           +K+++  L     + ++ +    +G++ S  +  +   G S+GF F  FK P   +  ++
Sbjct: 310 DKIYISNLPLNLGEDQVVELLKPFGDLLSFQLIKNIADGSSKGFCFCEFKNPSDAEVAIS 369

Query: 187 A--GEHTINNK 213
              G+ T  NK
Sbjct: 370 GLDGKDTYGNK 380



 Score = 30.7 bits (66), Expect = 0.18
 Identities = 11/48 (22%), Positives = 23/48 (47%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFES 398
           ++  L   + +D++      FG +L  ++  +      KGFCF  F++
Sbjct: 313 YISNLPLNLGEDQVVELLKPFGDLLSFQLIKNIADGSSKGFCFCEFKN 360


>SPAC23A1.09 |||RNA-binding protein|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 121

 Score = 31.1 bits (67), Expect = 0.14
 Identities = 13/76 (17%), Positives = 38/76 (50%)
 Frame = +3

Query: 258 VGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKR 437
           V G+  E +++++ + F++FG +  + +  D+     KG+  I + + +     +     
Sbjct: 14  VTGVHPEATEEQVEDLFADFGPVKNLHLNLDRRTGYVKGYALIEYATLEQAQKAVDEKNL 73

Query: 438 TIGGKEVDVKRATPKP 485
           ++  ++++V  A  +P
Sbjct: 74  SLLDEKLEVDFAFLEP 89


>SPBC902.04 |||RNA-binding protein|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 589

 Score = 31.1 bits (67), Expect = 0.14
 Identities = 15/61 (24%), Positives = 31/61 (50%)
 Frame = +3

Query: 282 SDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVD 461
           +++ IR+FFS+FG + +VE+      N     C + F S +  N+   +P+     + + 
Sbjct: 255 NEENIRSFFSKFGVLEKVEL------NPTHHSCVLEFTSHEAANNAWSSPEPIFNNRFIK 308

Query: 462 V 464
           +
Sbjct: 309 I 309


>SPCC10H11.02 |cwf23|SPCP31B10.01|DNAJ domain protein
           Cwf23|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 289

 Score = 30.3 bits (65), Expect = 0.24
 Identities = 12/43 (27%), Positives = 26/43 (60%)
 Frame = +3

Query: 270 SSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFES 398
           + +++D  +R+ +S FGT+  V +  D +K ++  +  I FE+
Sbjct: 176 ADQVNDAYLRSIYSSFGTLQNVVIQKDISKEKKYVYSIIVFET 218


>SPCC74.09 |mug24||RNA-binding protein, rrm type|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 654

 Score = 30.3 bits (65), Expect = 0.24
 Identities = 12/35 (34%), Positives = 21/35 (60%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPN 117
           +F+G L     +KE+ + FG +G+IE I + +  N
Sbjct: 301 VFIGNLPSSYHEKEIEEAFGKFGKIEHIKILSKKN 335



 Score = 25.0 bits (52), Expect = 9.1
 Identities = 10/29 (34%), Positives = 16/29 (55%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEM 341
           F+G L S   + EI   F +FG I  +++
Sbjct: 302 FIGNLPSSYHEKEIEEAFGKFGKIEHIKI 330


>SPCC550.02c |cwf5|ecm2|RNA-binding protein Cwf5|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 354

 Score = 28.7 bits (61), Expect = 0.74
 Identities = 23/80 (28%), Positives = 40/80 (50%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 192
           LF+ G+  E  D ++R HF  YG ++S+       + R++  AF+ FK   S +  +AA 
Sbjct: 214 LFLIGVEDELADYKIRKHFEQYGPLKSVVC-----SHRAK-CAFVNFKTRSSAE--IAAA 265

Query: 193 EHTINNKKVDPKKAKARHGK 252
                N  ++  + K + GK
Sbjct: 266 ASPDGNVVIEGFRLKVQWGK 285


>SPAC1952.05 |gcn5||histone acetyltransferase
           Gcn5|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 454

 Score = 27.5 bits (58), Expect = 1.7
 Identities = 14/29 (48%), Positives = 18/29 (62%)
 Frame = +1

Query: 130 RGFAFIVFKAPESIDKVMAAGEHTINNKK 216
           RGFA IVF A  S ++V   G H +N+ K
Sbjct: 187 RGFAEIVFCAIASNEQVRGYGSHLMNHLK 215


>SPCC285.14 |||TRAPP complex subunit Trs130 |Schizosaccharomyces
            pombe|chr 3|||Manual
          Length = 1150

 Score = 27.5 bits (58), Expect = 1.7
 Identities = 13/32 (40%), Positives = 21/32 (65%)
 Frame = +3

Query: 267  LSSEISDDEIRNFFSEFGTILEVEMPFDKTKN 362
            L+S   ++E+RN FSEF   LE E+ F+  ++
Sbjct: 958  LNSFFDNEELRNEFSEFIQHLESEVSFNSLRS 989


>SPAC2F7.11 |nrd1|msa2|RNA-binding protein Nrd1|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 529

 Score = 26.6 bits (56), Expect = 3.0
 Identities = 11/35 (31%), Positives = 20/35 (57%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPN 117
           +F+G L    T+ E+R+    +G I+ I + T+ N
Sbjct: 208 VFLGNLPNGITEDEIREDLEPFGPIDQIKIVTERN 242



 Score = 26.6 bits (56), Expect = 3.0
 Identities = 11/29 (37%), Positives = 19/29 (65%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEM 341
           F+G L + I++DEIR     FG I ++++
Sbjct: 209 FLGNLPNGITEDEIREDLEPFGPIDQIKI 237



 Score = 25.4 bits (53), Expect = 6.9
 Identities = 10/35 (28%), Positives = 19/35 (54%)
 Frame = +1

Query: 13  LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPN 117
           +++G      T + L++ F  +GEIE +N   + N
Sbjct: 416 IYIGNADDSLTIERLKEDFEEFGEIEYVNFFREKN 450


>SPAC1F5.04c |cdc12||formin Cdc12|Schizosaccharomyces pombe|chr
            1|||Manual
          Length = 1841

 Score = 26.6 bits (56), Expect = 3.0
 Identities = 13/42 (30%), Positives = 21/42 (50%)
 Frame = +1

Query: 175  KVMAAGEHTINNKKVDPKKAKARHGKILSEDSAVKSQMMKSE 300
            KV ++ E  +N   V P  +   H +ILS+ + +KS     E
Sbjct: 1783 KVYSSEETPVNKILVSPSVSILDHNRILSQSTPIKSPQRAQE 1824


>SPBC543.05c |||inorganic anion exchanger |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 517

 Score = 25.8 bits (54), Expect = 5.2
 Identities = 15/54 (27%), Positives = 24/54 (44%)
 Frame = -3

Query: 237 FSLLWVYFLVVDGVFTSSHDLVY*LWGLKHNEGKPS*SACVWICLYINTLYFTV 76
           F+LL    L + GV        Y ++ + H+ G P      WICL+    +F +
Sbjct: 85  FALLSSQPLCIVGVTGPITVFNYTVYDIMHDRGTPYFPFLCWICLWSMIFHFII 138


>SPAC16.02c |srp2||mRNA export factor Srp2|Schizosaccharomyces
          pombe|chr 1|||Manual
          Length = 365

 Score = 25.8 bits (54), Expect = 5.2
 Identities = 10/26 (38%), Positives = 17/26 (65%)
 Frame = +1

Query: 10 KLFVGGLSWETTDKELRDHFGAYGEI 87
          +LFVG +  + T +++ D F  YG+I
Sbjct: 5  RLFVGRIPPQATREDMMDFFKGYGQI 30


>SPAC222.09 |seb1||RNA-binding protein Seb1 |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 620

 Score = 25.4 bits (53), Expect = 6.9
 Identities = 11/41 (26%), Positives = 22/41 (53%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGF 377
           F+GG++  + +  +R+ F  FG++  + +      N R GF
Sbjct: 409 FLGGITRSVREPVLRSMFERFGSVQSLIL----NHNYRHGF 445


>SPAC2F7.09c |||sequence orphan|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 491

 Score = 25.4 bits (53), Expect = 6.9
 Identities = 13/31 (41%), Positives = 16/31 (51%)
 Frame = -3

Query: 93  TLYFTVCSKMITELLICGLPAQPTNKKFLVP 1
           T YF  C K ++E LI   P    N K L+P
Sbjct: 258 TQYFGSCFKQLSEGLIFDTPGYRGNLKSLLP 288


>SPBC649.05 |cut12|stf1|spindle pole body protein Cut12
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 548

 Score = 25.0 bits (52), Expect = 9.1
 Identities = 15/54 (27%), Positives = 26/54 (48%), Gaps = 5/54 (9%)
 Frame = +3

Query: 330 EVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTP-----KRTIGGKEVDVKRAT 476
           + E+P D  ++ R        +S+   N +LKTP     K+T+  K++    AT
Sbjct: 43  DAELPQDAKEDLRPTETLTPLKSKAAQNGILKTPGTLQIKKTVNFKDISKDAAT 96


>SPBC1289.12 |usp109||U1 snRNP-associated protein
           Usp109|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 352

 Score = 25.0 bits (52), Expect = 9.1
 Identities = 15/59 (25%), Positives = 28/59 (47%)
 Frame = +3

Query: 255 FVGGLSSEISDDEIRNFFSEFGTILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTP 431
           +V  L   I+  E+R++F  FG IL  ++      N  +      + +EQ +N++   P
Sbjct: 179 YVHQLPENITTQELRSYFLHFGEILYTQV----NNNSGRIVFAQRYFAEQAINEMNNFP 233


>SPBC23E6.04c |utp10||U3 snoRNP-associated protein Utp10
            |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 1649

 Score = 25.0 bits (52), Expect = 9.1
 Identities = 17/55 (30%), Positives = 27/55 (49%)
 Frame = -3

Query: 252  LPMSCFSLLWVYFLVVDGVFTSSHDLVY*LWGLKHNEGKPS*SACVWICLYINTL 88
            L M C +++   F     +F S  ++V   +GLK++      SA V I +  NTL
Sbjct: 1198 LAMDCLAVMAKRFSASPELFISPIEVVSGPYGLKNSARDVQVSAIVCITVLTNTL 1252


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,265,102
Number of Sequences: 5004
Number of extensions: 44151
Number of successful extensions: 263
Number of sequences better than 10.0: 53
Number of HSP's better than 10.0 without gapping: 201
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 260
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 283719918
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -