SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20080
         (709 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPCC330.07c |||membrane transporter|Schizosaccharomyces pombe|ch...    27   2.6  
SPAC1783.01 |||FAD binding protein|Schizosaccharomyces pombe|chr...    27   2.6  
SPBC1683.13c |||transcription factor |Schizosaccharomyces pombe|...    27   2.6  
SPAP27G11.15 |slx1||structure-specific endonuclease catalytic su...    26   4.6  
SPBC25B2.07c |mug164||microtubule-associated protein|Schizosacch...    26   6.1  
SPBC11C11.11c ||SPBC3B8.12|ATP-dependent DNA helicase Irc3 |Schi...    25   8.0  

>SPCC330.07c |||membrane transporter|Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 500

 Score = 27.1 bits (57), Expect = 2.6
 Identities = 12/25 (48%), Positives = 16/25 (64%)
 Frame = -2

Query: 210 LAIPLTRQAAHALPMSVEMFLFNLI 136
           +AI L   A H LPM V  FL++L+
Sbjct: 392 VAIHLVLDAVHKLPMQVYFFLYSLM 416


>SPAC1783.01 |||FAD binding protein|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 583

 Score = 27.1 bits (57), Expect = 2.6
 Identities = 16/36 (44%), Positives = 19/36 (52%)
 Frame = -3

Query: 569 FSKTFHKENLMVI*CYINAGVGINKFSTKVQIKRYN 462
           F+K FH +  M   C I AGVGI  F   VQ +  N
Sbjct: 422 FAKEFHNDGPM---CLIGAGVGIAPFRGFVQRRLAN 454


>SPBC1683.13c |||transcription factor |Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 618

 Score = 27.1 bits (57), Expect = 2.6
 Identities = 17/42 (40%), Positives = 21/42 (50%), Gaps = 4/42 (9%)
 Frame = +2

Query: 68  IYFKKYSRNCHTRPKQH----NRYIYCIKLNKNISTDMGNAC 181
           IYFKKY  +C      H       I  +KLN+NI  D G+ C
Sbjct: 504 IYFKKYDADCLPMTFIHIATSAARIILVKLNENIPED-GDVC 544


>SPAP27G11.15 |slx1||structure-specific endonuclease catalytic
           subunit |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 271

 Score = 26.2 bits (55), Expect = 4.6
 Identities = 9/35 (25%), Positives = 21/35 (60%)
 Frame = +2

Query: 53  YNSECIYFKKYSRNCHTRPKQHNRYIYCIKLNKNI 157
           +N + +   +Y+++C  R K+    +YC+K  K++
Sbjct: 75  WNWQNLGISRYTKDCDFRSKKQKTIMYCLKGLKHL 109


>SPBC25B2.07c |mug164||microtubule-associated
           protein|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 501

 Score = 25.8 bits (54), Expect = 6.1
 Identities = 12/42 (28%), Positives = 21/42 (50%)
 Frame = -2

Query: 273 PNSLESSRVNNHKPFPVHRTTLAIPLTRQAAHALPMSVEMFL 148
           P  +ESS V +H P  +   T  I  T  ++H+ P+ +   +
Sbjct: 460 PTLVESSTVVHHDPSYLQNQTSEINDTNHSSHSSPLDLNRMI 501


>SPBC11C11.11c ||SPBC3B8.12|ATP-dependent DNA helicase Irc3
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 606

 Score = 25.4 bits (53), Expect = 8.0
 Identities = 10/18 (55%), Positives = 13/18 (72%)
 Frame = +2

Query: 146 NKNISTDMGNACAACLVN 199
           NK+I  DMGN CA+ L +
Sbjct: 103 NKSIEIDMGNQCASGLAD 120


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,743,214
Number of Sequences: 5004
Number of extensions: 54483
Number of successful extensions: 110
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 109
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 110
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 329179816
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -