SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20079
         (698 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC23G7.05 |sui1|psu1|translation initiation factor eIF1|Schizo...    48   1e-06
SPBC211.02c |cwf3|syf1|complexed with Cdc5 protein Cwf3 |Schizos...    28   1.1  
SPCC645.06c |rgf3|lad1|RhoGEF Rgf3|Schizosaccharomyces pombe|chr...    28   1.1  
SPAC4F8.07c |hxk2||hexokinase 2 |Schizosaccharomyces pombe|chr 1...    26   6.0  
SPCC1183.07 |||U3 snoRNP-associated protein Rrp5|Schizosaccharom...    26   6.0  
SPBC25D12.06 |||RNA helicase |Schizosaccharomyces pombe|chr 2|||...    25   7.9  

>SPBC23G7.05 |sui1|psu1|translation initiation factor
           eIF1|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 109

 Score = 48.0 bits (109), Expect = 1e-06
 Identities = 25/55 (45%), Positives = 33/55 (60%), Gaps = 1/55 (1%)
 Frame = +2

Query: 143 SIQNLNTFDPFADAIKSSEDDVQD-GLVHVRIQQRNGRRR*LRCKAFPRNMT*RR 304
           +IQN NT DPFAD   + +DD Q    +H+RIQQRNGR+     +  PR    +R
Sbjct: 3   AIQNFNTVDPFAD---TGDDDAQPLNNIHIRIQQRNGRKTLTTVQGLPREFDQKR 54



 Score = 47.2 bits (107), Expect = 2e-06
 Identities = 19/43 (44%), Positives = 32/43 (74%)
 Frame = +3

Query: 339 GTVVEHPEYGEVLQLQGDQRENICQWLTKSGLVKPEQLKVHGF 467
           GT+V+  + GEV+QLQGDQR  + ++LT+   ++ + +K+HGF
Sbjct: 67  GTIVKDDDLGEVIQLQGDQRIKVMEFLTQQLGLQKKNIKIHGF 109



 Score = 44.0 bits (99), Expect = 2e-05
 Identities = 19/27 (70%), Positives = 23/27 (85%)
 Frame = +1

Query: 256 TLTTVQGLSSEYDLKKIVRACKKEFAC 336
           TLTTVQGL  E+D K+I+RA KK+FAC
Sbjct: 39  TLTTVQGLPREFDQKRILRALKKDFAC 65


>SPBC211.02c |cwf3|syf1|complexed with Cdc5 protein Cwf3
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 790

 Score = 28.3 bits (60), Expect = 1.1
 Identities = 12/32 (37%), Positives = 21/32 (65%)
 Frame = -2

Query: 202 VLRAFDSIGEWVECVEILDGHTIERRVSLFQR 107
           +LR   S+  W+  ++  +G T+E+RV LF+R
Sbjct: 25  LLRDPYSLKSWLRYIKTHEGSTLEKRVLLFER 56


>SPCC645.06c |rgf3|lad1|RhoGEF Rgf3|Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 1275

 Score = 28.3 bits (60), Expect = 1.1
 Identities = 16/39 (41%), Positives = 19/39 (48%)
 Frame = -2

Query: 382 SCSTSPYSGCSTTVPCTRTPSCMPARSSSGHIPRKGLAP 266
           SCS  PY   S T    RTPS +   SS    P+  L+P
Sbjct: 205 SCSPEPYLPLSPTRSPARTPSPIRLYSSDALRPQSPLSP 243


>SPAC4F8.07c |hxk2||hexokinase 2 |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 455

 Score = 25.8 bits (54), Expect = 6.0
 Identities = 20/64 (31%), Positives = 30/64 (46%), Gaps = 6/64 (9%)
 Frame = +3

Query: 258 ADYGARPFLGI*PEEDRAGMQEGVRVQGTVVEH-PEYGEVL-----QLQGDQRENICQWL 419
           A   A P   +     RAG +  V V G++VEH P + ++L     +L GD  + I   +
Sbjct: 372 ARMSAVPIASLYLSTGRAGKKSDVGVDGSLVEHYPHFVDMLREALRELIGDNEKLISIGI 431

Query: 420 TKSG 431
            K G
Sbjct: 432 AKDG 435


>SPCC1183.07 |||U3 snoRNP-associated protein Rrp5|Schizosaccharomyces
            pombe|chr 3|||Manual
          Length = 1690

 Score = 25.8 bits (54), Expect = 6.0
 Identities = 21/87 (24%), Positives = 42/87 (48%)
 Frame = +3

Query: 309  AGMQEGVRVQGTVVEHPEYGEVLQLQGDQRENICQWLTKSGLVKPEQLKVHGF*AALLKH 488
            A +  G  + GTVV+  +YG ++++ G   +NI     KS +     L +    ++  K 
Sbjct: 1231 ADIAVGSNLDGTVVKVGDYGVLIRIDG--TDNIVGLCHKSEIADAVVLNISKLYSSGDKV 1288

Query: 489  NMSTLNMYYERLRVVIINPIKNMYLES 569
                L++  E+ R+ +   +K+ Y +S
Sbjct: 1289 RAHVLDVDSEKRRIAL--GLKSSYFDS 1313


>SPBC25D12.06 |||RNA helicase |Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 565

 Score = 25.4 bits (53), Expect = 7.9
 Identities = 10/26 (38%), Positives = 18/26 (69%)
 Frame = +3

Query: 492 MSTLNMYYERLRVVIINPIKNMYLES 569
           +STL+MY+E L+ +  NP+    ++S
Sbjct: 126 LSTLSMYFEALKFLKHNPVAGKPVQS 151


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,801,385
Number of Sequences: 5004
Number of extensions: 56149
Number of successful extensions: 163
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 154
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 162
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 323158234
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -