SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20078
         (633 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPCC1840.03 |sal3|pse1|karyopherin Sal3|Schizosaccharomyces pomb...    31   0.10 
SPAC17H9.01 |cid16||poly|Schizosaccharomyces pombe|chr 1|||Manual      27   3.0  
SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual    27   3.0  
SPAPB17E12.10c |||SAM-dependent methyltransferase|Schizosaccharo...    27   3.0  
SPCC777.10c |ubc12||ubiquitin conjugating enzyme Ubc12|Schizosac...    26   5.2  
SPAC1834.07 |klp3|krp1|kinesin-like protein Klp3|Schizosaccharom...    26   5.2  
SPBC25H2.11c |||bromodomain protein|Schizosaccharomyces pombe|ch...    25   9.1  
SPBP16F5.03c |||phosphatidylinositol kinase |Schizosaccharomyces...    25   9.1  
SPAPB18E9.02c |ppk18||serine/threonine protein kinase Ppk18 |Sch...    25   9.1  

>SPCC1840.03 |sal3|pse1|karyopherin Sal3|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 1095

 Score = 31.5 bits (68), Expect = 0.10
 Identities = 15/42 (35%), Positives = 24/42 (57%)
 Frame = +1

Query: 130 LREQLLLTLQMDLSQYLRRKVCDVVSELARNHIDDDGNNQWP 255
           L+ QLL     +    +R K+CD ++E+AR+  D  G  +WP
Sbjct: 99  LQSQLLACFVKESVPTVRNKLCDTIAEIARSIYDCQG--EWP 138


>SPAC17H9.01 |cid16||poly|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1202

 Score = 26.6 bits (56), Expect = 3.0
 Identities = 16/55 (29%), Positives = 28/55 (50%)
 Frame = +1

Query: 199  VVSELARNHIDDDGNNQWPSSYSSCLPVPVRKIQTSKKLVLECLRLYQVYLEIVR 363
            +V   A N + D  ++ +PSSY+ C+ V     Q  + ++    +L   Y +IVR
Sbjct: 1023 LVKYWASNRLIDKTHHAFPSSYTWCIMVIFYLQQIPEPILPNLQKLSTQYSKIVR 1077


>SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1611

 Score = 26.6 bits (56), Expect = 3.0
 Identities = 13/37 (35%), Positives = 22/37 (59%), Gaps = 1/37 (2%)
 Frame = +1

Query: 178 LRRKVCDVVSELARNHIDDDGNNQW-PSSYSSCLPVP 285
           + RK+   +SE+  + ID+D  N+  PS+ +  LP P
Sbjct: 703 IERKLPSRISEVTEDSIDEDKQNEVDPSTSARALPPP 739


>SPAPB17E12.10c |||SAM-dependent
           methyltransferase|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 301

 Score = 26.6 bits (56), Expect = 3.0
 Identities = 9/28 (32%), Positives = 18/28 (64%)
 Frame = +2

Query: 272 VYLCQCARSKHQRSWY*NVYVCTRCIWK 355
           ++LC+   S H RS+  ++ +C +C+ K
Sbjct: 243 IFLCKVLESSHLRSFAEDLSMCFKCVKK 270


>SPCC777.10c |ubc12||ubiquitin conjugating enzyme
           Ubc12|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 177

 Score = 25.8 bits (54), Expect = 5.2
 Identities = 17/56 (30%), Positives = 27/56 (48%)
 Frame = +3

Query: 261 LQFMFTCASAQDPNIKEAGIRMFTSVPGVFGNRQTENLDVIKGMLISALQPNESMA 428
           LQF+F   +A+DP  KEA   +     G     +T     +KG L++ +  +  MA
Sbjct: 126 LQFLFLSPNAEDPLNKEAAADLHKDPQGFASRVRT----AMKGGLVNGISFDNVMA 177


>SPAC1834.07 |klp3|krp1|kinesin-like protein
           Klp3|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 554

 Score = 25.8 bits (54), Expect = 5.2
 Identities = 11/39 (28%), Positives = 20/39 (51%)
 Frame = -3

Query: 313 ASLMFGSCALAQVNMNCRNSATGCCHRHQYDS*PVQRLH 197
           A ++ G+  + + N +   S     HRH +DS  + RL+
Sbjct: 394 AEIIQGNRTIQESNNDRDESTVASIHRHNFDSDSINRLY 432


>SPBC25H2.11c |||bromodomain protein|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 979

 Score = 25.0 bits (52), Expect = 9.1
 Identities = 10/23 (43%), Positives = 14/23 (60%)
 Frame = -1

Query: 429 KPLIHLAAKQILTCLLSHPSFQS 361
           KPL H   K++ T +L H  F+S
Sbjct: 694 KPLAHDVLKKLCTIILFHAGFES 716


>SPBP16F5.03c |||phosphatidylinositol kinase |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 3699

 Score = 25.0 bits (52), Expect = 9.1
 Identities = 10/32 (31%), Positives = 15/32 (46%)
 Frame = -1

Query: 438 EFAKPLIHLAAKQILTCLLSHPSFQSDDFQIH 343
           EF  PL+      +L CL +H      + Q+H
Sbjct: 870 EFLDPLLDSIMPDLLICLWNHSRLNQSNNQLH 901


>SPAPB18E9.02c |ppk18||serine/threonine protein kinase Ppk18
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1316

 Score = 25.0 bits (52), Expect = 9.1
 Identities = 14/39 (35%), Positives = 23/39 (58%)
 Frame = -3

Query: 397 INMPFITSKFSV*RFPNTPGTDVNILIPASLMFGSCALA 281
           I++PFI    S  R  N P +++ +L PAS +F +  L+
Sbjct: 294 IHLPFIPE--STTREDNQPFSEIRLLSPASEVFNAKTLS 330


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,663,231
Number of Sequences: 5004
Number of extensions: 55021
Number of successful extensions: 129
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 123
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 129
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 281707720
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -