SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20076
         (660 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC1556.06.1 |meu1|SPAC1556.06a, SPAC1556.06|sequence orphan|Sc...    28   1.4  
SPCC1919.15 |brl1|SPCC790.01, rfp2|ubiquitin-protein ligase E3 B...    27   1.8  
SPAC2C4.17c |||MS ion channel protein 2|Schizosaccharomyces pomb...    27   3.2  
SPCC1620.14c |snf22|SPCC830.01c|ATP-dependent DNA helicase Snf22...    26   5.5  
SPAP7G5.03 |||conjugation protein |Schizosaccharomyces pombe|chr...    26   5.5  
SPBC14F5.12c |cbh2||centromere binding protein Cbh2|Schizosaccha...    26   5.5  
SPBC19C2.05 |ran1|pat1|serine/threonine protein kinase Ran1|Schi...    25   7.3  
SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosac...    25   7.3  
SPAC12G12.03 |cip2||RNA-binding protein Cip2|Schizosaccharomyces...    25   9.7  

>SPAC1556.06.1 |meu1|SPAC1556.06a, SPAC1556.06|sequence
           orphan|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 776

 Score = 27.9 bits (59), Expect = 1.4
 Identities = 10/31 (32%), Positives = 21/31 (67%)
 Frame = +2

Query: 257 VEMRVERLRKDTVRIEEEKDSLLSTLDSIKH 349
           V++  +RLRK+ + ++ E+  LL  L+ ++H
Sbjct: 366 VQIECKRLRKENLFLQSERTHLLRELEELRH 396


>SPCC1919.15 |brl1|SPCC790.01, rfp2|ubiquitin-protein ligase E3
           Brl1|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 692

 Score = 27.5 bits (58), Expect = 1.8
 Identities = 20/88 (22%), Positives = 45/88 (51%), Gaps = 5/88 (5%)
 Frame = +2

Query: 260 EMRVERLRKDTVRIEEEKDSLLSTLDSIKHSE--LLLDISE-C--DKDDITRYADRILSR 424
           E+  +R+++D +    E+ S+ +  D I  SE   +L+  E C  D D+I++  +   S+
Sbjct: 192 ELEWKRVQQDQLTSASER-SIENIADDIPASEPKAILENGEGCLNDNDNISKLKNNFQSQ 250

Query: 425 AMTVEVTVRTDRDHQQEEALYQVNMYID 508
           A  ++  + +  D   +++     +Y+D
Sbjct: 251 ADLMQANINSKLDELSQKSTRAAQLYVD 278


>SPAC2C4.17c |||MS ion channel protein 2|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 840

 Score = 26.6 bits (56), Expect = 3.2
 Identities = 12/33 (36%), Positives = 20/33 (60%)
 Frame = -1

Query: 246 LLSVCLSAPAFLEPRIRR*GVVVNPLDTQSLMQ 148
           LL+  L AP    PR+RR   ++  +DT+S+ +
Sbjct: 270 LLTAALDAPYHDSPRVRRQDYLLGLIDTRSMSE 302


>SPCC1620.14c |snf22|SPCC830.01c|ATP-dependent DNA helicase
           Snf22|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 1680

 Score = 25.8 bits (54), Expect = 5.5
 Identities = 11/26 (42%), Positives = 16/26 (61%)
 Frame = -2

Query: 545 ALTASLCTDITSYRCTCSPDTELPPA 468
           A  A L + I +Y C  SP+ ++PPA
Sbjct: 433 AQLAMLKSQIVAYNCLNSPNGQVPPA 458


>SPAP7G5.03 |||conjugation protein |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 703

 Score = 25.8 bits (54), Expect = 5.5
 Identities = 12/40 (30%), Positives = 20/40 (50%)
 Frame = +1

Query: 493 EHVHR*LVMSVHNDAVSAHSRCQTYMNACTSQPDPNAGTT 612
           E+++  +  S+HN  +S +S   T+MN   S      G T
Sbjct: 441 ENINNNMFGSIHNTTLSLNSTLNTFMNELNSSMTSAFGDT 480


>SPBC14F5.12c |cbh2||centromere binding protein
           Cbh2|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 514

 Score = 25.8 bits (54), Expect = 5.5
 Identities = 16/51 (31%), Positives = 23/51 (45%)
 Frame = +2

Query: 287 DTVRIEEEKDSLLSTLDSIKHSELLLDISECDKDDITRYADRILSRAMTVE 439
           +T   EEE   LLST D+I     LL+  E  +D    +   +L     +E
Sbjct: 459 ETDEEEEESQYLLSTKDAINAINTLLNFQEQSEDGNVLFTRTLLQFQKVLE 509


>SPBC19C2.05 |ran1|pat1|serine/threonine protein kinase
           Ran1|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 470

 Score = 25.4 bits (53), Expect = 7.3
 Identities = 9/21 (42%), Positives = 13/21 (61%)
 Frame = -3

Query: 493 HLIQSFLLLMVSVSAHCHLYG 431
           HLI++  L ++S   HCH  G
Sbjct: 118 HLIKTVFLQLISAVEHCHSVG 138


>SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit
           Spp42|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 2363

 Score = 25.4 bits (53), Expect = 7.3
 Identities = 11/33 (33%), Positives = 20/33 (60%)
 Frame = +3

Query: 216 TQAPKDRLIAVLDKSRCEWRGSEKTQSGLKKKR 314
           T A    L   L++   +WR S+K++ G+K+K+
Sbjct: 40  TPAQSGNLEKQLNERARKWRASQKSKFGVKRKQ 72


>SPAC12G12.03 |cip2||RNA-binding protein Cip2|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 576

 Score = 25.0 bits (52), Expect = 9.7
 Identities = 10/21 (47%), Positives = 16/21 (76%)
 Frame = -3

Query: 286 FSEPLHSHLDLSSTAISLSFG 224
           F+EP HSH+  S+++ +LS G
Sbjct: 192 FNEPSHSHVPNSASSTALSRG 212


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,673,817
Number of Sequences: 5004
Number of extensions: 54203
Number of successful extensions: 163
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 159
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 163
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 299817502
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -