SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20075
         (715 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC4D7.02c |||glycerophosphoryl diester phosphodiesterase |Schi...    26   4.7  
SPBC4F6.11c |||asparagine synthase |Schizosaccharomyces pombe|ch...    26   4.7  
SPAC4A8.08c |vas1||mitochondrial valine-tRNA ligase Vas1|Schizos...    26   6.1  
SPBC6B1.07 |prp1|zer1|U4/U6 x U5 tri-snRNP complex subunit Prp1|...    25   8.1  
SPBC3D6.10 |apn2||AP-endonuclease Apn2|Schizosaccharomyces pombe...    25   8.1  

>SPAC4D7.02c |||glycerophosphoryl diester phosphodiesterase
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 319

 Score = 26.2 bits (55), Expect = 4.7
 Identities = 10/23 (43%), Positives = 14/23 (60%)
 Frame = -2

Query: 501 KVSTCAWAKTTMVACTKSSPSSP 433
           KVS C W+   + AC + +PS P
Sbjct: 174 KVSFCLWSHRFIPACDRYAPSIP 196


>SPBC4F6.11c |||asparagine synthase |Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 548

 Score = 26.2 bits (55), Expect = 4.7
 Identities = 12/34 (35%), Positives = 20/34 (58%)
 Frame = +2

Query: 176 ALATRFKSLHKSPLE*FHGAAEVVRQAGRRIFCP 277
           AL ++ K+  K  L+   G   ++R+ GRR+ CP
Sbjct: 479 ALFSKMKTTDKMRLDLVGGDKLILRELGRRLGCP 512


>SPAC4A8.08c |vas1||mitochondrial valine-tRNA ligase
            Vas1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 950

 Score = 25.8 bits (54), Expect = 6.1
 Identities = 16/58 (27%), Positives = 29/58 (50%)
 Frame = +2

Query: 362  SVQPQTLSLNAITEFCDLVPRQQFGEDGDDLVQATIVVLAQAQVDTLQSMAKVFAPSK 535
            S++P     +AI +  +L  +    ED  DL++    +L++   DT+  + K   PSK
Sbjct: 832  SLEPLKYFYDAIEQSTNLKLKSISQEDTIDLMRNQTFILSRISSDTILLVPKKLYPSK 889


>SPBC6B1.07 |prp1|zer1|U4/U6 x U5 tri-snRNP complex subunit
           Prp1|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 906

 Score = 25.4 bits (53), Expect = 8.1
 Identities = 24/87 (27%), Positives = 35/87 (40%)
 Frame = +3

Query: 15  NDLTPKTTTNKLRVRKGRSVVHRNLEDNYGAVVIANHEALAQVLEQVQQSATMQPSLRGL 194
           N + PK   +   +RK R ++   +E N      A+    A  LE+V    +   SL  L
Sbjct: 247 NSMVPKNANDLGDIRKARKLLQSVIETN---PKHASGWVAAARLEEVANKLSQAQSLI-L 302

Query: 195 KACTNLRWSDFTVQPKSSVKPAGEYSV 275
           K C N   S+        + PA E  V
Sbjct: 303 KGCENCSRSEDVWLEAIRLHPAAEAKV 329


>SPBC3D6.10 |apn2||AP-endonuclease Apn2|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 523

 Score = 25.4 bits (53), Expect = 8.1
 Identities = 13/30 (43%), Positives = 17/30 (56%)
 Frame = -2

Query: 684 PQRHERGQSLRDFLDPSRLKALEAVDQLQH 595
           P   E  Q +RD L PSRL  L  + ++QH
Sbjct: 214 PSIMESRQWIRDLLLPSRLGLLLDIGRIQH 243


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,012,141
Number of Sequences: 5004
Number of extensions: 60586
Number of successful extensions: 187
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 177
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 187
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 333194204
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -