SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20074
         (622 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPCC576.06c |||tyrosine-tRNA ligase|Schizosaccharomyces pombe|ch...    27   2.9  
SPAC14C4.10c |||Nudix family hydrolase|Schizosaccharomyces pombe...    25   8.8  

>SPCC576.06c |||tyrosine-tRNA ligase|Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 445

 Score = 26.6 bits (56), Expect = 2.9
 Identities = 11/30 (36%), Positives = 16/30 (53%)
 Frame = +2

Query: 392 LLCLSYASGRGLVHSTKVLQKCMTVASILI 481
           L CL     R L+H+T +LQ    V S+ +
Sbjct: 5   LACLKQLQARSLIHNTTLLQPSCNVNSVYL 34


>SPAC14C4.10c |||Nudix family hydrolase|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 329

 Score = 25.0 bits (52), Expect = 8.8
 Identities = 9/20 (45%), Positives = 14/20 (70%)
 Frame = +3

Query: 348 QNFVKFNYTYTCLSVYYVYL 407
           Q + + N+ +TCL+ YY YL
Sbjct: 282 QVYPRGNWVFTCLNGYYPYL 301


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,276,507
Number of Sequences: 5004
Number of extensions: 42010
Number of successful extensions: 93
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 92
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 93
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 273658928
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -