SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20072
         (691 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC1E8.02 |||ubiquitin family protein, unknown|Schizosaccharomy...    29   0.63 
SPAC23A1.06c |cmk2|mkp2|MAPK-activated protein kinase Cmk2|Schiz...    26   5.9  
SPCC1322.06 |kap113||karyopherin Kap113|Schizosaccharomyces pomb...    26   5.9  
SPCC1494.10 ||SPCC70.01|transcription factor |Schizosaccharomyce...    25   7.8  
SPAC3F10.11c |abc2||glutathione S-conjugate-exporting ATPase Abc...    25   7.8  
SPAC25G10.01 ||SPAC2C4.18|RNA-binding protein|Schizosaccharomyce...    25   7.8  
SPAC17A2.12 |||ATP-dependent DNA helicase|Schizosaccharomyces po...    25   7.8  

>SPBC1E8.02 |||ubiquitin family protein, unknown|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 603

 Score = 29.1 bits (62), Expect = 0.63
 Identities = 11/36 (30%), Positives = 20/36 (55%)
 Frame = +2

Query: 314 HLEYHEGERREIDTNSPGALPSRESSLGGDQDVRVA 421
           H++ HE  +  ++T +PG + S  + L  DQ   V+
Sbjct: 199 HIQAHEMAQESLETRNPGNISSSSAPLASDQSPTVS 234


>SPAC23A1.06c |cmk2|mkp2|MAPK-activated protein kinase
           Cmk2|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 504

 Score = 25.8 bits (54), Expect = 5.9
 Identities = 9/21 (42%), Positives = 15/21 (71%)
 Frame = +2

Query: 371 LPSRESSLGGDQDVRVAGLPG 433
           L ++  + GGD+++RVA  PG
Sbjct: 41  LAAKNVNAGGDEEIRVANYPG 61


>SPCC1322.06 |kap113||karyopherin Kap113|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 983

 Score = 25.8 bits (54), Expect = 5.9
 Identities = 10/45 (22%), Positives = 26/45 (57%)
 Frame = +3

Query: 291 ASLAEWEYTSNITKENEEKSIQTHLELSRQEKAAWEETKMYGWQD 425
           +SL+ W      +KE ++ ++ +++++SR    A     ++G+Q+
Sbjct: 187 SSLSSWMMILESSKEIKDSTLLSYMQISRYTLKACRRLVVFGFQN 231


>SPCC1494.10 ||SPCC70.01|transcription factor |Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 964

 Score = 25.4 bits (53), Expect = 7.8
 Identities = 14/35 (40%), Positives = 16/35 (45%), Gaps = 1/35 (2%)
 Frame = -2

Query: 435 NPGSPATRTSWSPPRLLSLDG-RAPGEFVSISLRS 334
           NP  P +RTSW  P+        APG   S S  S
Sbjct: 765 NPAFPQSRTSWMMPQSFDTSSLNAPGAKDSSSFSS 799


>SPAC3F10.11c |abc2||glutathione S-conjugate-exporting ATPase
            Abc2|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1463

 Score = 25.4 bits (53), Expect = 7.8
 Identities = 10/26 (38%), Positives = 17/26 (65%)
 Frame = -3

Query: 539  SIPFPIQFSSSLEFVVRQSRNAQLTV 462
            S+ + +Q + SL FVVRQS + +  +
Sbjct: 1164 SLSYAVQITQSLTFVVRQSVDVETNI 1189


>SPAC25G10.01 ||SPAC2C4.18|RNA-binding protein|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 297

 Score = 25.4 bits (53), Expect = 7.8
 Identities = 14/39 (35%), Positives = 16/39 (41%)
 Frame = +2

Query: 272 RPEEEQGQLSRMGVHLEYHEGERREIDTNSPGALPSRES 388
           RP  E+    R   H E+H       DT    ALPS  S
Sbjct: 252 RPRRERHFHGRSFAHAEHHSVPNMRNDTPGNEALPSHSS 290


>SPAC17A2.12 |||ATP-dependent DNA helicase|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 897

 Score = 25.4 bits (53), Expect = 7.8
 Identities = 15/80 (18%), Positives = 35/80 (43%)
 Frame = -3

Query: 686 HRPRCAIPPRHVSTPQGLGSWRISQLSQAPKIDRIYSHSCTSRSSRWRNSIPFPIQFSSS 507
           H P  ++    +   Q        +L    +ID++++     R+S W++S     Q   +
Sbjct: 673 HGPLNSLKQLELDMNQSFSEQESIKLRWENRIDQMFTKKFGKRASEWKSSSKLN-QARQT 731

Query: 506 LEFVVRQSRNAQLTVFLEHS 447
           +  ++   RN ++ V+ + S
Sbjct: 732 ILDIIGSKRNEKILVYSQFS 751


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,754,022
Number of Sequences: 5004
Number of extensions: 53291
Number of successful extensions: 179
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 174
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 179
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 319939482
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -