SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20070
         (639 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC15A10.05c |mug182||YjeF family protein|Schizosaccharomyces p...    90   3e-19
SPBC29A10.10c |||tRNA-splicing endonuclease positive effector |S...    29   0.57 
SPCC645.06c |rgf3|lad1|RhoGEF Rgf3|Schizosaccharomyces pombe|chr...    27   2.3  
SPAC2G11.09 |||DUF221 family protein|Schizosaccharomyces pombe|c...    27   3.0  
SPAC3H8.09c |nab3||poly|Schizosaccharomyces pombe|chr 1|||Manual       27   3.0  
SPAC13F5.01c |msh1|SPAC23C11.18c|MutS protein homolog 1|Schizosa...    25   7.0  
SPAC32A11.03c |phx1||homeobox transcription factor Phx1|Schizosa...    25   9.2  

>SPAC15A10.05c |mug182||YjeF family protein|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 242

 Score = 89.8 bits (213), Expect = 3e-19
 Identities = 42/66 (63%), Positives = 51/66 (77%)
 Frame = +2

Query: 311 LNQSEAAALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHSSALIVCGPGNNGGD 490
           L+ S A ALD +L +   FS+DQLMELAGLSV+ A+ + +PPS +S  LI CGPGNNGGD
Sbjct: 6   LSASAAKALDAELMSAGAFSIDQLMELAGLSVSQAVYREYPPSQYSQVLICCGPGNNGGD 65

Query: 491 GLVAAR 508
           GLVAAR
Sbjct: 66  GLVAAR 71



 Score = 27.9 bits (59), Expect = 1.3
 Identities = 10/33 (30%), Positives = 20/33 (60%)
 Frame = +1

Query: 520 FGYNVSVHYPKRTPKPLYENLLEQCIRFNVNII 618
           +GY  +V+YPK +   LY+ L +Q    ++ ++
Sbjct: 76  YGYKPTVYYPKPSSPELYKRLCKQLDDLDIPVV 108


>SPBC29A10.10c |||tRNA-splicing endonuclease positive effector
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 1944

 Score = 29.1 bits (62), Expect = 0.57
 Identities = 13/36 (36%), Positives = 20/36 (55%), Gaps = 1/36 (2%)
 Frame = -2

Query: 200 LRRFFYCFSFTN-NRYVVWFQMSVKIIFYLNPMCML 96
           +R   + FSF N N Y+VWF+  +     L P C++
Sbjct: 56  VRECLFLFSFQNDNEYLVWFKKHLNERLQLCPKCIV 91


>SPCC645.06c |rgf3|lad1|RhoGEF Rgf3|Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 1275

 Score = 27.1 bits (57), Expect = 2.3
 Identities = 12/27 (44%), Positives = 15/27 (55%)
 Frame = -2

Query: 335 VLPLLTD*GTASQCCIDSYCSS*FRCY 255
           VLP LT+ G  S  C    C S ++CY
Sbjct: 394 VLPFLTNGGCYSYICRSRSCPSKYQCY 420


>SPAC2G11.09 |||DUF221 family protein|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 796

 Score = 26.6 bits (56), Expect = 3.0
 Identities = 8/16 (50%), Positives = 12/16 (75%)
 Frame = -1

Query: 102 HVTYIGRYHRLYT*WY 55
           H TYIGR+H+ +  W+
Sbjct: 430 HNTYIGRWHKFFQGWF 445


>SPAC3H8.09c |nab3||poly|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 738

 Score = 26.6 bits (56), Expect = 3.0
 Identities = 10/20 (50%), Positives = 15/20 (75%)
 Frame = -3

Query: 259 VISFATRNIRALPNNLYNNI 200
           +++ AT NIR  P++ YNNI
Sbjct: 98  ILNSATSNIRLTPSDTYNNI 117


>SPAC13F5.01c |msh1|SPAC23C11.18c|MutS protein homolog
           1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 941

 Score = 25.4 bits (53), Expect = 7.0
 Identities = 11/27 (40%), Positives = 17/27 (62%)
 Frame = +2

Query: 521 SDTMYRYIILNAHPNLCMKTFWNNA*D 601
           S + +R ++LN HP+  +K   NNA D
Sbjct: 467 SSSAFRLLLLNMHPHDELKQLINNAVD 493


>SPAC32A11.03c |phx1||homeobox transcription factor
           Phx1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 942

 Score = 25.0 bits (52), Expect = 9.2
 Identities = 10/28 (35%), Positives = 15/28 (53%)
 Frame = -1

Query: 573 IQRFGCAFRIMYRYIVSEQLHILAATKP 490
           IQ  G  +RI Y + V E +H+    +P
Sbjct: 474 IQFQGIQYRIEYSFFVIESIHVFRVEEP 501


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,593,785
Number of Sequences: 5004
Number of extensions: 52854
Number of successful extensions: 124
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 117
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 124
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 285732116
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -