SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20069
         (636 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC22A12.15c |bip1|bip|BiP |Schizosaccharomyces pombe|chr 1|||M...   137   1e-33
SPAC13G7.02c |ssa1||heat shock protein Ssa1|Schizosaccharomyces ...   128   9e-31
SPCC1739.13 |ssa2||heat shock protein Ssa2|Schizosaccharomyces p...   126   2e-30
SPBC1709.05 |sks2|hsc1|heat shock protein Sks2|Schizosaccharomyc...   113   2e-26
SPAC664.11 |ssc1|ssp1|Hsp70 chaperone mtHsp70|Schizosaccharomyce...    97   1e-21
SPAC110.04c |pss1|ssp1, SPAP14E8.01c|heat shock protein Pss1|Sch...    62   5e-11
SPAC57A7.12 |||heat shock protein Pdr13 |Schizosaccharomyces pom...    56   6e-09
SPBC119.07 |ppk19||serine/threonine protein kinase Ppk19|Schizos...    27   3.0  
SPCC550.08 |||N-acetyltransferase |Schizosaccharomyces pombe|chr...    26   5.2  
SPBC8D2.20c |sec31||COPII-coated vesicle component Sec31 |Schizo...    25   6.9  
SPBC27.03 |meu25||sequence orphan|Schizosaccharomyces pombe|chr ...    25   6.9  
SPAC16C9.06c |upf1||ATP-dependent RNA helicase Upf1|Schizosaccha...    25   6.9  
SPAC4F10.03c |||2'-O-ribose methyltransferase|Schizosaccharomyce...    25   9.1  
SPAC22E12.18 |||conserved fungal protein|Schizosaccharomyces pom...    25   9.1  

>SPAC22A12.15c |bip1|bip|BiP |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 663

 Score =  137 bits (331), Expect = 1e-33
 Identities = 65/96 (67%), Positives = 77/96 (80%)
 Frame = +2

Query: 251 EEKDKDIGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAA 430
           +   +  GTVIGIDLGTTYSCV V KNGRVEIIANDQGNRITPSYVAFT+D ERL+G+AA
Sbjct: 28  DNSTESYGTVIGIDLGTTYSCVAVMKNGRVEIIANDQGNRITPSYVAFTED-ERLVGEAA 86

Query: 431 KNQLTTNPENTVFDAKRLIGREWSDQLYNMMLSSSP 538
           KNQ  +NPENT+FD KRLIGR++ ++     + S P
Sbjct: 87  KNQAPSNPENTIFDIKRLIGRKFDEKTMAKDIKSFP 122



 Score = 45.2 bits (102), Expect = 8e-06
 Identities = 20/43 (46%), Positives = 27/43 (62%)
 Frame = +1

Query: 508 TVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           T+  D+K FPF +V   ++P V+V      K F PEEISAM+L
Sbjct: 113 TMAKDIKSFPFHIVNDKNRPLVEVNVGGKKKKFTPEEISAMIL 155


>SPAC13G7.02c |ssa1||heat shock protein Ssa1|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 644

 Score =  128 bits (308), Expect = 9e-31
 Identities = 63/107 (58%), Positives = 76/107 (71%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVG + N RVEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+  NP N
Sbjct: 5   IGIDLGTTYSCVGHFSNNRVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPHN 63

Query: 461 TVFDAKRLIGREWSDQLYNMMLSSSPSRSLKRTANLMFKYKLHKATK 601
           T+FDAKRLIGR ++D      +   P + +++    + + +    TK
Sbjct: 64  TIFDAKRLIGRRFNDPEVQSDMKHWPFKVIEKDGKPLIQVEFKGETK 110



 Score = 55.6 bits (128), Expect = 6e-09
 Identities = 25/44 (56%), Positives = 32/44 (72%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P VQ D+K +PFKV+EK+ KP +QV+     K F PEEIS+MVL
Sbjct: 79  PEVQSDMKHWPFKVIEKDGKPLIQVEFKGETKTFTPEEISSMVL 122


>SPCC1739.13 |ssa2||heat shock protein Ssa2|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 647

 Score =  126 bits (305), Expect = 2e-30
 Identities = 63/107 (58%), Positives = 75/107 (70%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVG + N RVEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+  NP N
Sbjct: 5   IGIDLGTTYSCVGHFSNNRVEIIANDQGNRTTPSYVAFT-DTERLIGDAAKNQVAMNPHN 63

Query: 461 TVFDAKRLIGREWSDQLYNMMLSSSPSRSLKRTANLMFKYKLHKATK 601
           T+FDAKRLIGR++ D      +   P + + +    + + +    TK
Sbjct: 64  TIFDAKRLIGRKFDDPEVQSDMKHWPFKVISKDGKPVLQVEYKGETK 110



 Score = 52.8 bits (121), Expect = 4e-08
 Identities = 24/44 (54%), Positives = 31/44 (70%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P VQ D+K +PFKV+ K+ KP +QV+     K F PEEIS+MVL
Sbjct: 79  PEVQSDMKHWPFKVISKDGKPVLQVEYKGETKTFTPEEISSMVL 122


>SPBC1709.05 |sks2|hsc1|heat shock protein Sks2|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 613

 Score =  113 bits (272), Expect = 2e-26
 Identities = 54/75 (72%), Positives = 60/75 (80%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCV V++   VEII NDQG R TPS+VAFT+  ERL+GDAAKNQ   NP N
Sbjct: 9   IGIDLGTTYSCVAVWETANVEIIPNDQGARTTPSFVAFTET-ERLVGDAAKNQAAMNPRN 67

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR + D
Sbjct: 68  TVFDAKRLIGRRYED 82



 Score = 44.4 bits (100), Expect = 1e-05
 Identities = 21/46 (45%), Positives = 28/46 (60%)
 Frame = +1

Query: 499 E*PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           E P  Q D+K +PFKV++ N  P ++V      K F  +EISAMVL
Sbjct: 81  EDPETQKDIKHWPFKVIDNNGIPTIEVNYLGEKKQFTAQEISAMVL 126


>SPAC664.11 |ssc1|ssp1|Hsp70 chaperone mtHsp70|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 674

 Score = 97.5 bits (232), Expect = 1e-21
 Identities = 46/82 (56%), Positives = 58/82 (70%)
 Frame = +2

Query: 260 DKDIGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQ 439
           +K  G VIGIDLGTT SC+ + +    ++IAN +G R TPS VAFT+DGERL+G +AK Q
Sbjct: 46  EKVKGPVIGIDLGTTTSCLAIMEGQTPKVIANAEGTRTTPSVVAFTKDGERLVGVSAKRQ 105

Query: 440 LTTNPENTVFDAKRLIGREWSD 505
              NPENT F  KRLIGR + +
Sbjct: 106 AVINPENTFFATKRLIGRRFKE 127



 Score = 27.9 bits (59), Expect = 1.3
 Identities = 15/44 (34%), Positives = 27/44 (61%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P VQ D+K  P+K+VE +S     ++ ++G K ++P +I   +L
Sbjct: 128 PEVQRDIKEVPYKIVE-HSNGDAWLE-ARG-KTYSPSQIGGFIL 168


>SPAC110.04c |pss1|ssp1, SPAP14E8.01c|heat shock protein
           Pss1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 720

 Score = 62.5 bits (145), Expect = 5e-11
 Identities = 30/76 (39%), Positives = 47/76 (61%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPE 457
           V+GID G + + + V +N  +++I N+  NR TPS V++  +  R +G+AAK+   +N  
Sbjct: 7   VVGIDFGNSKTVIAVARNRAIDVIVNEVSNRSTPSLVSY-GERSRFLGEAAKSAEASNFR 65

Query: 458 NTVFDAKRLIGREWSD 505
           NTV   KRL GR + D
Sbjct: 66  NTVGSLKRLAGRTYDD 81


>SPAC57A7.12 |||heat shock protein Pdr13 |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 566

 Score = 55.6 bits (128), Expect = 6e-09
 Identities = 29/89 (32%), Positives = 53/89 (59%), Gaps = 1/89 (1%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNP 454
           TVIGI  G   S +   ++G+ +++AN++GNR  PS +++  D E   G  A+ QL  N 
Sbjct: 25  TVIGISFGNQNSSIAFNRDGKTDVLANEEGNRQIPSILSYHGDQE-YHGVQARGQLVRNA 83

Query: 455 ENTVFDAKRLIGREWSD-QLYNMMLSSSP 538
           +N+V + + L+G+   +  L++   S++P
Sbjct: 84  DNSVTNFRDLLGKSHDELTLHHCHYSANP 112


>SPBC119.07 |ppk19||serine/threonine protein kinase
            Ppk19|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 1706

 Score = 26.6 bits (56), Expect = 3.0
 Identities = 15/43 (34%), Positives = 23/43 (53%)
 Frame = +2

Query: 242  RRQEEKDKDIGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNR 370
            RR  E+++    V G  LG TY+   V ++G VE+   D  N+
Sbjct: 1266 RRNGERNR-FSVVNGCFLGNTYAFASVTQDGSVEVHRLDVNNQ 1307


>SPCC550.08 |||N-acetyltransferase |Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 247

 Score = 25.8 bits (54), Expect = 5.2
 Identities = 14/32 (43%), Positives = 17/32 (53%)
 Frame = -1

Query: 579 YLNMRFAVLFNDLEGEELNIMLYSWSLHSRPI 484
           YL      +FN  + E L I L S  LH+RPI
Sbjct: 146 YLRKLIEPIFNICDQEGLPIYLESSHLHNRPI 177


>SPBC8D2.20c |sec31||COPII-coated vesicle component Sec31
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 1224

 Score = 25.4 bits (53), Expect = 6.9
 Identities = 14/57 (24%), Positives = 28/57 (49%), Gaps = 3/57 (5%)
 Frame = -1

Query: 180 KIYRLKDSEINKNLNKIIFTATIRSL*NAFIKHLRIQTVHRYFSF---NCSRKTRDS 19
           KI+  +DS++ KN+ + + T  + S   A ++  +I       +F    C +  RD+
Sbjct: 545 KIFNPEDSDLEKNITEALLTGDVLSAVKACLEEKKISEALFLSTFGGKECRKCVRDA 601


>SPBC27.03 |meu25||sequence orphan|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 622

 Score = 25.4 bits (53), Expect = 6.9
 Identities = 9/20 (45%), Positives = 13/20 (65%)
 Frame = +2

Query: 404 GERLIGDAAKNQLTTNPENT 463
           GE ++ D+  N   TNP+NT
Sbjct: 6   GENIVSDSIVNMELTNPDNT 25


>SPAC16C9.06c |upf1||ATP-dependent RNA helicase
           Upf1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 925

 Score = 25.4 bits (53), Expect = 6.9
 Identities = 9/14 (64%), Positives = 11/14 (78%)
 Frame = -1

Query: 396 VKATYEGVMRFPWS 355
           +K TYEG +R PWS
Sbjct: 284 MKLTYEGELRAPWS 297


>SPAC4F10.03c |||2'-O-ribose methyltransferase|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 285

 Score = 25.0 bits (52), Expect = 9.1
 Identities = 17/55 (30%), Positives = 26/55 (47%), Gaps = 2/55 (3%)
 Frame = -2

Query: 509 VGHSIHDQSDAWHQRQCFQGW**AGFWQHHQLN--VHHLE*RPRMKV*CGFPGHW 351
           +G S  D+ DA+++    QGW     ++  QLN   +  E   R+   C  PG W
Sbjct: 1   MGRSSKDKRDAYYRLAKEQGWRARSAFKLLQLNEQFNLFEGAKRVVDLCAAPGSW 55


>SPAC22E12.18 |||conserved fungal protein|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 336

 Score = 25.0 bits (52), Expect = 9.1
 Identities = 14/50 (28%), Positives = 21/50 (42%)
 Frame = +2

Query: 338 VEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPENTVFDAKRLI 487
           +E  AND    ITP   A         G+  +N+L    E  +F  + L+
Sbjct: 80  LEKYANDMATTITPLIAAVQVFNAEKYGEIIQNRLKMYAERVLFGIEALL 129


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,685,351
Number of Sequences: 5004
Number of extensions: 56491
Number of successful extensions: 152
Number of sequences better than 10.0: 14
Number of HSP's better than 10.0 without gapping: 139
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 147
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 283719918
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -