SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20065
         (649 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC1002.14 |itt1||ubiquitin-protein ligase E3 |Schizosaccharomy...    31   0.14 
SPAC29A4.11 |rga3||GTPase activating protein Rga3|Schizosaccharo...    30   0.33 
SPAC56F8.12 |||conserved fungal protein|Schizosaccharomyces pomb...    29   0.76 
SPAP8A3.14c |||mitochondrial inner membrane protein |Schizosacch...    28   1.0  
SPAC2F3.16 |||ubiquitin-protein ligase E3 |Schizosaccharomyces p...    27   1.8  
SPBC15C4.02 |||ABC1 kinase family protein|Schizosaccharomyces po...    27   3.1  
SPCC1259.08 |||conserved fungal protein|Schizosaccharomyces pomb...    26   4.1  
SPAC2G11.05c |||BRO1 domain protein|Schizosaccharomyces pombe|ch...    25   7.1  
SPCC645.07 |rgf1||RhoGEF for Rho1, Rgf1|Schizosaccharomyces pomb...    25   9.4  
SPBC21D10.09c |||ubiquitin-protein ligase E3 |Schizosaccharomyce...    25   9.4  
SPCC320.04c |||GTPase Gem1 |Schizosaccharomyces pombe|chr 3|||Ma...    25   9.4  
SPBC3H7.03c |||2-oxoglutarate dehydrogenase |Schizosaccharomyces...    25   9.4  
SPBC21C3.01c |vps13a|vps1301, SPBC31F10.18c|chorein homolog|Schi...    25   9.4  
SPAC17H9.10c |ddb1||damaged DNA binding protein Ddb1 |Schizosacc...    25   9.4  

>SPAC1002.14 |itt1||ubiquitin-protein ligase E3 |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 435

 Score = 31.1 bits (67), Expect = 0.14
 Identities = 11/24 (45%), Positives = 13/24 (54%)
 Frame = -3

Query: 332 RCVERCDVCCHMTLTCTNCYALIC 261
           R VER D CCHM   C   +  +C
Sbjct: 373 RVVERIDGCCHMNCLCGTHFCFLC 396


>SPAC29A4.11 |rga3||GTPase activating protein
           Rga3|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 969

 Score = 29.9 bits (64), Expect = 0.33
 Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 1/38 (2%)
 Frame = +3

Query: 75  TPRQKVNTLRNVER-TETLPLRRGTCRHRFCTI*SEDF 185
           +P QKVN  + +E  T T PL + T ++RF T   + F
Sbjct: 256 SPLQKVNKQQQIESPTATFPLSKNTWKNRFHTFHKQSF 293


>SPAC56F8.12 |||conserved fungal protein|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 394

 Score = 28.7 bits (61), Expect = 0.76
 Identities = 15/38 (39%), Positives = 15/38 (39%)
 Frame = -2

Query: 273 CPNLCSAYLVCFLGWPFVHRTELGHVFFDESLRFRSYR 160
           CP L  AY VC  GW      EL      E  R R  R
Sbjct: 300 CPPLILAYTVCIYGWAVPSIAELEKEAIHEECRQRKRR 337


>SPAP8A3.14c |||mitochondrial inner membrane protein
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 677

 Score = 28.3 bits (60), Expect = 1.0
 Identities = 10/31 (32%), Positives = 19/31 (61%)
 Frame = -3

Query: 524 LNHYKKYFHLLHSILNEGKIYKKAIIIHWKI 432
           L  + K FH+  S L + +I ++ ++ HWK+
Sbjct: 127 LRKFAKVFHIKSSSLRKKEIIERILLDHWKL 157


>SPAC2F3.16 |||ubiquitin-protein ligase E3 |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 425

 Score = 27.5 bits (58), Expect = 1.8
 Identities = 12/27 (44%), Positives = 17/27 (62%)
 Frame = +2

Query: 194 NTWPSSVLCTNGHPRKQTRYALHRLGH 274
           NTW S++ C + + R  T+Y  H LGH
Sbjct: 340 NTWISTIRCNDCNSRCDTKY--HFLGH 364


>SPBC15C4.02 |||ABC1 kinase family protein|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 594

 Score = 26.6 bits (56), Expect = 3.1
 Identities = 10/17 (58%), Positives = 13/17 (76%)
 Frame = -2

Query: 276 LCPNLCSAYLVCFLGWP 226
           L P+L S Y +CFLG+P
Sbjct: 42  LIPHLNSLYSICFLGFP 58


>SPCC1259.08 |||conserved fungal protein|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 394

 Score = 26.2 bits (55), Expect = 4.1
 Identities = 10/14 (71%), Positives = 12/14 (85%)
 Frame = -3

Query: 404 NYKSSFQSHTSNEV 363
           NYKSSF +H S+EV
Sbjct: 360 NYKSSFSAHVSSEV 373


>SPAC2G11.05c |||BRO1 domain protein|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 701

 Score = 25.4 bits (53), Expect = 7.1
 Identities = 17/64 (26%), Positives = 33/64 (51%)
 Frame = -3

Query: 539 LLSFTLNHYKKYFHLLHSILNEGKIYKKAIIIHWKILQSIFFVQNNYKSSFQSHTSNEVK 360
           +LSF+    KKY  LL ++ NE +I ++   I  +  +     +N Y++    +  N++K
Sbjct: 622 ILSFSQETEKKYKFLLQTVRNETEIARELYNIICRAEERYSQYENRYEN---ENRLNKIK 678

Query: 359 IVDS 348
           +  S
Sbjct: 679 LQHS 682


>SPCC645.07 |rgf1||RhoGEF for Rho1, Rgf1|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 1334

 Score = 25.0 bits (52), Expect = 9.4
 Identities = 12/27 (44%), Positives = 16/27 (59%)
 Frame = -1

Query: 466 FTKRLSSSIGKFFNQFSLFKIITSLVF 386
           F  RL+   GK  N+F+LF +   LVF
Sbjct: 801 FLSRLNVESGKAENKFNLFHLNQQLVF 827


>SPBC21D10.09c |||ubiquitin-protein ligase E3 |Schizosaccharomyces
            pombe|chr 2|||Manual
          Length = 1610

 Score = 25.0 bits (52), Expect = 9.4
 Identities = 13/20 (65%), Positives = 16/20 (80%), Gaps = 1/20 (5%)
 Frame = +3

Query: 105  NVERTETLPLRR-GTCRHRF 161
            +VERT  LP +R GTCRH+F
Sbjct: 1566 SVERT--LPNKRCGTCRHKF 1583


>SPCC320.04c |||GTPase Gem1 |Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 630

 Score = 25.0 bits (52), Expect = 9.4
 Identities = 12/42 (28%), Positives = 22/42 (52%)
 Frame = -1

Query: 511 KNIFICFILF*TKAKFTKRLSSSIGKFFNQFSLFKIITSLVF 386
           +N+F+CF++       T  LSS I    N+ +   ++ S+ F
Sbjct: 419 RNVFLCFVVGSKSCGKTALLSSFINNNTNRLTPNTVVNSVEF 460


>SPBC3H7.03c |||2-oxoglutarate dehydrogenase |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 1009

 Score = 25.0 bits (52), Expect = 9.4
 Identities = 11/24 (45%), Positives = 13/24 (54%)
 Frame = -3

Query: 440 WKILQSIFFVQNNYKSSFQSHTSN 369
           W IL+S F    NYKS  +   SN
Sbjct: 556 WDILESSFESSKNYKSDHREWLSN 579


>SPBC21C3.01c |vps13a|vps1301, SPBC31F10.18c|chorein
            homolog|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 3071

 Score = 25.0 bits (52), Expect = 9.4
 Identities = 17/53 (32%), Positives = 25/53 (47%)
 Frame = -2

Query: 600  LFYIDFDLHLITLTCHIYEGSFIFHIESLQKIFSSASFYFKRRQNLQKGYHHP 442
            +F  D D H  T+ C +Y  +   H+E  +K F  A FY    +N  K  + P
Sbjct: 1049 IFLYDCDQHFSTV-C-LYSANM--HMEFREKFFLQARFYDLEVKNHMKSNNPP 1097


>SPAC17H9.10c |ddb1||damaged DNA binding protein Ddb1
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1072

 Score = 25.0 bits (52), Expect = 9.4
 Identities = 10/25 (40%), Positives = 16/25 (64%)
 Frame = +2

Query: 287 TSVSCDSKRHIVRHISPVLGVNPLF 361
           T +SC    +I  +++P LGVN L+
Sbjct: 652 TPLSCTEMLNISSYVNPSLGVNMLY 676


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,606,451
Number of Sequences: 5004
Number of extensions: 55138
Number of successful extensions: 139
Number of sequences better than 10.0: 14
Number of HSP's better than 10.0 without gapping: 137
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 139
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 291768710
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -