SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20064
         (713 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC458.03 |||nuclear telomere cap complex subunit |Schizosaccha...    29   0.87 
SPAC24H6.11c |||sulfate transporter |Schizosaccharomyces pombe|c...    26   4.7  
SPCC550.09 |||peroxin Pex32 |Schizosaccharomyces pombe|chr 3|||M...    26   6.1  
SPBC32F12.01c ||SPBC685.10c|inositol phosphosphingolipid phospho...    25   8.1  
SPBC119.16c |||conserved fungal protein|Schizosaccharomyces pomb...    25   8.1  
SPBC543.07 |pek1|skh1, mkk1|MAP kinase kinase Pek1 |Schizosaccha...    25   8.1  

>SPAC458.03 |||nuclear telomere cap complex subunit
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 868

 Score = 28.7 bits (61), Expect = 0.87
 Identities = 19/68 (27%), Positives = 32/68 (47%)
 Frame = +3

Query: 234 ACSLTLSKSVILWEQQWHPCAIVGSMTIMYLLIWLLDLNTLASIAIVGLILNFVDFMVPV 413
           A  L   KS    E + H   ++ ++  +     L++ + +   AIV L+L  +D   PV
Sbjct: 533 ASKLIKRKSAFGTELRDHADELLQTLISLQNRFDLMNFDEMQMTAIVELLLTCLDICGPV 592

Query: 414 ICNQLYGS 437
           IC  L+ S
Sbjct: 593 ICTNLFVS 600


>SPAC24H6.11c |||sulfate transporter |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 958

 Score = 26.2 bits (55), Expect = 4.7
 Identities = 18/68 (26%), Positives = 33/68 (48%), Gaps = 5/68 (7%)
 Frame = +3

Query: 222 FRRLACSLTLSKSVILWEQQW-HPCAI----VGSMTIMYLLIWLLDLNTLASIAIVGLIL 386
           F + +  L LS ++   +Q+W HP  I    V +  I Y+L+W +   +L  +   G + 
Sbjct: 334 FAKWSIPLFLSSALEFAQQRWPHPFLIPSFFVIAPAIFYVLVWAIPGMSLEYLRETGWVF 393

Query: 387 NFVDFMVP 410
           +  +  VP
Sbjct: 394 SSTETNVP 401


>SPCC550.09 |||peroxin Pex32 |Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 535

 Score = 25.8 bits (54), Expect = 6.1
 Identities = 14/36 (38%), Positives = 19/36 (52%)
 Frame = +1

Query: 601 LDILFY*QHFPVVFIVNSSTALAWHTAHGISIVFFC 708
           + IL +      +FIV SS  LAWH+   +  V FC
Sbjct: 267 MSILIFCLPTQALFIVLSSVFLAWHSP-PLQAVLFC 301


>SPBC32F12.01c ||SPBC685.10c|inositol phosphosphingolipid
           phospholipase C |Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 424

 Score = 25.4 bits (53), Expect = 8.1
 Identities = 17/56 (30%), Positives = 27/56 (48%), Gaps = 1/56 (1%)
 Frame = +3

Query: 531 SIPYEIPAHLCIT-LSPSVHCVL*LGYPLLLTTFSCCIYCQQ*YCFGLAYSAWDFN 695
           SIP  I  H+ I    P+   V+ L + ++LT  +        +C GL +  W+FN
Sbjct: 343 SIPLIIGVHVAIAWCDPAWLKVIILFFTVMLTIAAVV----NGFCIGLLFGRWEFN 394


>SPBC119.16c |||conserved fungal protein|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 448

 Score = 25.4 bits (53), Expect = 8.1
 Identities = 12/24 (50%), Positives = 15/24 (62%), Gaps = 1/24 (4%)
 Frame = -3

Query: 93  MQFDFFFHKLQGNYSKFVG-NQKE 25
           ++FD  F KLQGN    +G N KE
Sbjct: 150 LEFDSLFEKLQGNKFAILGANSKE 173


>SPBC543.07 |pek1|skh1, mkk1|MAP kinase kinase Pek1
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 363

 Score = 25.4 bits (53), Expect = 8.1
 Identities = 11/21 (52%), Positives = 12/21 (57%)
 Frame = -1

Query: 521 CKSPIIVAYYNASTNFFKCLL 459
           C SP IV YY A  N  +C L
Sbjct: 132 CTSPYIVKYYGACYNNAECQL 152


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,981,703
Number of Sequences: 5004
Number of extensions: 61520
Number of successful extensions: 178
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 175
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 178
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 333194204
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -