SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20063
         (681 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC19F8.08 |rps401|rps4-1, rps4, SPBC25H2.17c|40S ribosomal pro...   155   4e-39
SPBC21B10.10 |rps402|rps4-2|40S ribosomal protein S4|Schizosacch...   155   7e-39
SPAC959.07 |rps403|rps4-3, rps4|40S ribosomal protein S4|Schizos...   154   1e-38
SPAC24B11.10c |chr3|cfh1|chitin synthase regulatory factor Chr3 ...    28   1.4  
SPAC1F5.11c |||phosphatidylinositol kinase |Schizosaccharomyces ...    27   3.3  
SPBC1198.02 |dea2||adenine deaminase Dea2|Schizosaccharomyces po...    26   5.8  
SPAC1093.01 ||SPAC12B10.18|PPR repeat protein|Schizosaccharomyce...    25   7.7  

>SPBC19F8.08 |rps401|rps4-1, rps4, SPBC25H2.17c|40S ribosomal
           protein S4|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 262

 Score =  155 bits (377), Expect = 4e-39
 Identities = 69/86 (80%), Positives = 76/86 (88%)
 Frame = +3

Query: 249 KGDGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKVKRVA 428
           K DGKVRTD T+P GFMDV+S+EKT E FRL+YD+KGRFT+HRIT EEAKYKLCKVKRV 
Sbjct: 71  KVDGKVRTDSTFPTGFMDVISVEKTGEHFRLVYDIKGRFTVHRITAEEAKYKLCKVKRVQ 130

Query: 429 TGPKNVPYLVTHDGRTIRYPDPLIKV 506
            G K VP+LVTHDGRTIRYPDPLIKV
Sbjct: 131 LGAKGVPFLVTHDGRTIRYPDPLIKV 156



 Score =  123 bits (296), Expect = 3e-29
 Identities = 55/75 (73%), Positives = 61/75 (81%)
 Frame = +1

Query: 40  MARGPKKHLKRLNAPKAWMLDKLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALTGNE 219
           M RGPKKHLKR+ AP  W+LDKL G YAP+PS GPHK RECLPL++FLRNRLKYAL G E
Sbjct: 1   MVRGPKKHLKRVAAPHHWLLDKLSGTYAPKPSPGPHKARECLPLIVFLRNRLKYALNGRE 60

Query: 220 VLKIVKQRLIKVMGK 264
           V  I+ QRLIKV GK
Sbjct: 61  VKAILMQRLIKVDGK 75



 Score = 65.3 bits (152), Expect = 8e-12
 Identities = 29/62 (46%), Positives = 42/62 (67%)
 Frame = +2

Query: 491 PTYQSQDSIQLDIATTKIMDFIKFESGNLCMITGGRNLGRVGTIVFPRETSRLFDIVHIK 670
           P  +  D+I+L++ T KI  FIKF++    M+TGGRN+GRVGTIV        F+I+H+K
Sbjct: 152 PLIKVNDTIKLNLETNKIESFIKFDTSAQVMVTGGRNMGRVGTIVHREHHLGSFEIIHVK 211

Query: 671 DS 676
           D+
Sbjct: 212 DA 213


>SPBC21B10.10 |rps402|rps4-2|40S ribosomal protein
           S4|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 262

 Score =  155 bits (375), Expect = 7e-39
 Identities = 68/84 (80%), Positives = 75/84 (89%)
 Frame = +3

Query: 255 DGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKVKRVATG 434
           DGKVRTD T+P GFMDV+S+EKT E FRL+YD+KGRFT+HRIT EEAKYKLCKVKRV  G
Sbjct: 73  DGKVRTDSTFPTGFMDVISVEKTGEHFRLVYDIKGRFTVHRITAEEAKYKLCKVKRVQLG 132

Query: 435 PKNVPYLVTHDGRTIRYPDPLIKV 506
            K VP+LVTHDGRTIRYPDPLIKV
Sbjct: 133 AKGVPFLVTHDGRTIRYPDPLIKV 156



 Score =  121 bits (292), Expect = 8e-29
 Identities = 54/75 (72%), Positives = 61/75 (81%)
 Frame = +1

Query: 40  MARGPKKHLKRLNAPKAWMLDKLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALTGNE 219
           M RGPKKHLKR+ AP  W+LDKL G YAP+PS GPHK RECLPL++FLRNRLKYAL G E
Sbjct: 1   MVRGPKKHLKRVAAPHHWLLDKLSGTYAPKPSPGPHKARECLPLIVFLRNRLKYALNGRE 60

Query: 220 VLKIVKQRLIKVMGK 264
           V  I+ QRLI+V GK
Sbjct: 61  VKAILMQRLIQVDGK 75



 Score = 65.3 bits (152), Expect = 8e-12
 Identities = 29/62 (46%), Positives = 42/62 (67%)
 Frame = +2

Query: 491 PTYQSQDSIQLDIATTKIMDFIKFESGNLCMITGGRNLGRVGTIVFPRETSRLFDIVHIK 670
           P  +  D+I+L++ T KI  FIKF++    M+TGGRN+GRVGTIV        F+I+H+K
Sbjct: 152 PLIKVNDTIKLNLETNKIESFIKFDTSAQVMVTGGRNMGRVGTIVHREHHLGSFEIIHVK 211

Query: 671 DS 676
           D+
Sbjct: 212 DA 213


>SPAC959.07 |rps403|rps4-3, rps4|40S ribosomal protein
           S4|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 262

 Score =  154 bits (374), Expect = 1e-38
 Identities = 68/86 (79%), Positives = 76/86 (88%)
 Frame = +3

Query: 249 KGDGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKVKRVA 428
           K DGKVRTD T+P GFMDV+S++KT E FRL+YD+KGRFT+HRIT EEAKYKLCKVKRV 
Sbjct: 71  KVDGKVRTDSTFPTGFMDVISVDKTGEHFRLVYDIKGRFTVHRITAEEAKYKLCKVKRVQ 130

Query: 429 TGPKNVPYLVTHDGRTIRYPDPLIKV 506
            G K VP+LVTHDGRTIRYPDPLIKV
Sbjct: 131 LGAKGVPFLVTHDGRTIRYPDPLIKV 156



 Score =  123 bits (296), Expect = 3e-29
 Identities = 55/75 (73%), Positives = 61/75 (81%)
 Frame = +1

Query: 40  MARGPKKHLKRLNAPKAWMLDKLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALTGNE 219
           M RGPKKHLKR+ AP  W+LDKL G YAP+PS GPHK RECLPL++FLRNRLKYAL G E
Sbjct: 1   MVRGPKKHLKRVAAPHHWLLDKLSGTYAPKPSPGPHKARECLPLIVFLRNRLKYALNGRE 60

Query: 220 VLKIVKQRLIKVMGK 264
           V  I+ QRLIKV GK
Sbjct: 61  VKAILMQRLIKVDGK 75



 Score = 65.3 bits (152), Expect = 8e-12
 Identities = 29/62 (46%), Positives = 42/62 (67%)
 Frame = +2

Query: 491 PTYQSQDSIQLDIATTKIMDFIKFESGNLCMITGGRNLGRVGTIVFPRETSRLFDIVHIK 670
           P  +  D+I+L++ T KI  FIKF++    M+TGGRN+GRVGTIV        F+I+H+K
Sbjct: 152 PLIKVNDTIKLNLETNKIESFIKFDTSAQVMVTGGRNMGRVGTIVHREHHLGSFEIIHVK 211

Query: 671 DS 676
           D+
Sbjct: 212 DA 213


>SPAC24B11.10c |chr3|cfh1|chitin synthase regulatory factor Chr3
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 932

 Score = 27.9 bits (59), Expect = 1.4
 Identities = 18/70 (25%), Positives = 28/70 (40%)
 Frame = +3

Query: 72  LKRSQSMDVGQTWRCVCTETVNRSPQVARVLAPGDFPEESSEVCFDRKRSPENCETTPHK 251
           LK S+++   +    +  +   R P    V+ P   P E     FDR+    N      +
Sbjct: 336 LKSSETLKNPRNDDLLTLQQPPRYPHSQMVMLPARSPVEVPAPTFDRRNVSRNSNNNSPE 395

Query: 252 GDGKVRTDPT 281
           G    RT+PT
Sbjct: 396 GYDNNRTNPT 405


>SPAC1F5.11c |||phosphatidylinositol kinase |Schizosaccharomyces
            pombe|chr 1|||Manual
          Length = 3655

 Score = 26.6 bits (56), Expect = 3.3
 Identities = 15/62 (24%), Positives = 32/62 (51%), Gaps = 1/62 (1%)
 Frame = +3

Query: 300  DVVSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKVKRVATGPKNVPYL-VTHDGRT 476
            +V S+EK N++F + Y+V  +     +   +   K+  ++ ++   KNVP + V H    
Sbjct: 1718 NVSSLEKCNQIFSIFYEVFFQHPSTNVYANDEGIKIGALQIISFFLKNVPEITVQHQTEM 1777

Query: 477  IR 482
            ++
Sbjct: 1778 LK 1779


>SPBC1198.02 |dea2||adenine deaminase Dea2|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 367

 Score = 25.8 bits (54), Expect = 5.8
 Identities = 18/84 (21%), Positives = 38/84 (45%)
 Frame = +3

Query: 174 DFPEESSEVCFDRKRSPENCETTPHKGDGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDV 353
           DFP E  +  + +  + +    T H G+     DP+Y    +D +S+++ +   RL+ D 
Sbjct: 186 DFPPELFQEVY-KLAAEKGIRRTGHAGE---EGDPSYIRSGLDNLSLQRIDHGIRLVED- 240

Query: 354 KGRFTIHRITPEEAKYKLCKVKRV 425
             +  + R+  E     +C +  +
Sbjct: 241 --KELMKRVAEENIMLTMCPLSNL 262


>SPAC1093.01 ||SPAC12B10.18|PPR repeat protein|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 1261

 Score = 25.4 bits (53), Expect = 7.7
 Identities = 12/22 (54%), Positives = 15/22 (68%)
 Frame = -2

Query: 395 SLLRGDTVDCESALNIID*TKQ 330
           S  RGDT D  +ALNI + TK+
Sbjct: 898 STRRGDTDDATTALNIFEETKR 919


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,064,913
Number of Sequences: 5004
Number of extensions: 65717
Number of successful extensions: 178
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 169
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 178
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 313902888
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -